DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and wdr21

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_956995.1 Gene:wdr21 / 393674 ZFINID:ZDB-GENE-040109-2 Length:505 Species:Danio rerio


Alignment Length:250 Identity:60/250 - (24%)
Similarity:94/250 - (37%) Gaps:49/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 SLVRASL-ANSNADMSANGAIASHLQLIPKKAPSIPKPKWHAPWKLSRVISGHLGWVRCIAVEPG 183
            ||:.||| :|.|.|..  |.:.|.      |..:    .|...|.|:               ...
Zfish   252 SLLPASLFSNFNPDQP--GMLCSF------KIST----AWSCAWCLN---------------PQA 289

  Fly   184 NEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDLEYN-- 246
            ::.|:||...||| :.|..:|:....|..  |.|.....:.:.|.||:.....::...||...  
Zfish   290 DKTFSTGLSRRVI-VTDAVTGRRATYLAD--SDVLAQQFALRAPVLFNGCRSGEIFSIDLRQRDR 351

  Fly   247 --------KVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVAS 303
                    |..|.|..  ||:.|:.|....:.|..:......::||:|.|..|....||.|..|.
Zfish   352 GRMGFHGWKTSRFYQE--SAITSVQLLQDENYLLAADMLGKIKLWDIRVKRCVKQYEGHHNEYAY 414

  Fly   304 VVAQATNPQ--IITGSHDSTVRLWDLAAGKSVCTLTN-H---KKSVRSIVLHPSL 352
            :......|:  ::....|...|||.|...:.:.|:.: |   |.|:.::|..|.|
Zfish   415 LPIHINEPEGLLLAVGQDCYTRLWSLQDSRLLRTIPSPHPAGKDSIPNVVFSPQL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 47/207 (23%)
WD40 164..458 CDD:238121 46/204 (23%)
WD40 repeat 177..212 CDD:293791 9/34 (26%)
WD40 repeat 218..254 CDD:293791 8/45 (18%)
WD40 repeat 259..295 CDD:293791 8/35 (23%)
WD40 repeat 302..337 CDD:293791 8/36 (22%)
WD40 repeat 343..378 CDD:293791 2/9 (22%)
WD40 repeat 386..426 CDD:293791
WD40 repeat 433..457 CDD:293791
wdr21NP_956995.1 WD40 119..474 CDD:225201 59/249 (24%)
WD40 repeat 278..315 CDD:293791 11/52 (21%)
WD40 repeat 321..363 CDD:293791 6/41 (15%)
WD40 <367..>467 CDD:295369 25/101 (25%)
WD40 repeat 370..406 CDD:293791 8/35 (23%)
WD40 repeat 414..450 CDD:293791 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.