Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956995.1 | Gene: | wdr21 / 393674 | ZFINID: | ZDB-GENE-040109-2 | Length: | 505 | Species: | Danio rerio |
Alignment Length: | 250 | Identity: | 60/250 - (24%) |
---|---|---|---|
Similarity: | 94/250 - (37%) | Gaps: | 49/250 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 SLVRASL-ANSNADMSANGAIASHLQLIPKKAPSIPKPKWHAPWKLSRVISGHLGWVRCIAVEPG 183
Fly 184 NEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDLEYN-- 246
Fly 247 --------KVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVAS 303
Fly 304 VVAQATNPQ--IITGSHDSTVRLWDLAAGKSVCTLTN-H---KKSVRSIVLHPSL 352 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 47/207 (23%) |
WD40 | 164..458 | CDD:238121 | 46/204 (23%) | ||
WD40 repeat | 177..212 | CDD:293791 | 9/34 (26%) | ||
WD40 repeat | 218..254 | CDD:293791 | 8/45 (18%) | ||
WD40 repeat | 259..295 | CDD:293791 | 8/35 (23%) | ||
WD40 repeat | 302..337 | CDD:293791 | 8/36 (22%) | ||
WD40 repeat | 343..378 | CDD:293791 | 2/9 (22%) | ||
WD40 repeat | 386..426 | CDD:293791 | |||
WD40 repeat | 433..457 | CDD:293791 | |||
wdr21 | NP_956995.1 | WD40 | 119..474 | CDD:225201 | 59/249 (24%) |
WD40 repeat | 278..315 | CDD:293791 | 11/52 (21%) | ||
WD40 repeat | 321..363 | CDD:293791 | 6/41 (15%) | ||
WD40 | <367..>467 | CDD:295369 | 25/101 (25%) | ||
WD40 repeat | 370..406 | CDD:293791 | 8/35 (23%) | ||
WD40 repeat | 414..450 | CDD:293791 | 7/35 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |