| Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_477395.1 | Gene: | alphaCOP / 38199 | FlyBaseID: | FBgn0025725 | Length: | 1234 | Species: | Drosophila melanogaster |
| Alignment Length: | 269 | Identity: | 69/269 - (25%) |
|---|---|---|---|
| Similarity: | 115/269 - (42%) | Gaps: | 35/269 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 175 VRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVK 239
Fly 240 CWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVASV 304
Fly 305 VAQATNPQIITGSHDSTVRLWDLAA--GKSVC-----------------------------TLTN 338
Fly 339 HKKSVRSIVLHPSLYMFASASPDN-IKQWRCPEGKF--VQNISGHTSIVNCMAAN-SEGVLVSGG 399
Fly 400 DNGTMFFWD 408 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 69/269 (26%) |
| WD40 | 164..458 | CDD:238121 | 69/269 (26%) | ||
| WD40 repeat | 177..212 | CDD:293791 | 7/34 (21%) | ||
| WD40 repeat | 218..254 | CDD:293791 | 11/35 (31%) | ||
| WD40 repeat | 259..295 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 302..337 | CDD:293791 | 12/65 (18%) | ||
| WD40 repeat | 343..378 | CDD:293791 | 12/37 (32%) | ||
| WD40 repeat | 386..426 | CDD:293791 | 4/24 (17%) | ||
| WD40 repeat | 433..457 | CDD:293791 | |||
| alphaCOP | NP_477395.1 | WD40 | <2..320 | CDD:225201 | 69/269 (26%) |
| WD40 | 5..321 | CDD:238121 | 69/269 (26%) | ||
| WD40 repeat | 15..49 | CDD:293791 | 7/33 (21%) | ||
| WD40 repeat | 57..91 | CDD:293791 | 9/33 (27%) | ||
| WD40 repeat | 97..133 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 138..205 | CDD:293791 | 13/66 (20%) | ||
| WD40 repeat | 212..249 | CDD:293791 | 11/36 (31%) | ||
| WD40 repeat | 255..291 | CDD:293791 | 5/26 (19%) | ||
| WD40 repeat | 299..352 | CDD:293791 | |||
| Coatomer_WDAD | 354..765 | CDD:281977 | |||
| COPI_C | 815..1228 | CDD:284395 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||