DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and Lis-1

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001246361.1 Gene:Lis-1 / 36791 FlyBaseID:FBgn0015754 Length:411 Species:Drosophila melanogaster


Alignment Length:391 Identity:103/391 - (26%)
Similarity:164/391 - (41%) Gaps:66/391 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 EKTAPLVTGTHTSLVR---------ASLANSNADMSANGAIASHLQLIPKKAPS--IPKPKWHAP 161
            :|...|:....||::|         |.|..:..:: ..||...:     |:.|.  ||:|    |
  Fly    45 KKFGGLLEKKWTSVIRLQKKVMELEAKLTEAEKEV-IEGAPTKN-----KRTPGEWIPRP----P 99

  Fly   162 WKLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKH 226
            .|.|  ::||...:..:...|......:.:.|..|:|||..:|:.:.||.||..:|:.||...:.
  Fly   100 EKFS--LTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDAQG 162

  Fly   227 PYLFSCGEDRQVKCWDLEYN-KVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKAN 290
            ..|.||..|..:|.||.:.: :.|:..|||...|.|:|..|..|.:.::.||.|.::|::.|...
  Fly   163 KLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYC 227

  Fly   291 VHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLHPSLYMF 355
            |.|.|||...|..|..........|.|:|.|:|:|...:......|.:|:.:|..|...|.....
  Fly   228 VKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAAS 292

  Fly   356 A---SASPDN------------------IKQWRCPEGKFVQNISGHTSIVNCMAANSEG-VLVSG 398
            |   :|..||                  |:.|....|..:..:|||.:.|..:|.:..| .|||.
  Fly   293 AINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSA 357

  Fly   399 GDNGTMFFWDWR------TGYNFQRFQAPVQPGSMDSEAGIFAMCFDQSGSRLITAEADKTIKVY 457
            .|:.|:..||.|      |.|..|.|...:.              |.::...:|:...|:|:||:
  Fly   358 SDDKTIRVWDLRNKRCMKTLYAHQHFCTSID--------------FHKAHPYVISGSVDQTVKVW 408

  Fly   458 K 458
            :
  Fly   409 E 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 89/325 (27%)
WD40 164..458 CDD:238121 87/322 (27%)
WD40 repeat 177..212 CDD:293791 9/34 (26%)
WD40 repeat 218..254 CDD:293791 10/36 (28%)
WD40 repeat 259..295 CDD:293791 12/35 (34%)
WD40 repeat 302..337 CDD:293791 7/34 (21%)
WD40 repeat 343..378 CDD:293791 10/55 (18%)
WD40 repeat 386..426 CDD:293791 14/46 (30%)
WD40 repeat 433..457 CDD:293791 5/23 (22%)
Lis-1NP_001246361.1 LisH 9..40 CDD:128913
WD40 100..409 CDD:238121 88/324 (27%)
WD40 repeat 111..148 CDD:293791 9/36 (25%)
WD40 repeat 154..191 CDD:293791 10/36 (28%)
WD40 repeat 196..232 CDD:293791 12/35 (34%)
WD40 repeat 239..274 CDD:293791 7/34 (21%)
WD40 repeat 280..336 CDD:293791 10/55 (18%)
WD40 repeat 342..378 CDD:293791 12/35 (34%)
WD40 repeat 384..408 CDD:293791 5/37 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.