DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and Tbl1xr1

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001102411.1 Gene:Tbl1xr1 / 365755 RGDID:1560053 Length:514 Species:Rattus norvegicus


Alignment Length:473 Identity:91/473 - (19%)
Similarity:157/473 - (33%) Gaps:179/473 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 AASGAGSLVKYNAGARPAEKTA-PLVTGTHTSLVRASLANSNADMSANGAIASHLQLIPKKAPSI 153
            ||:.|.:.......|:..|.|| ....|.||      :||::.||.   .:...:::.|.||.  
  Rat   110 AAAAAAAATNQQGSAKNGENTANGEENGAHT------IANNHTDMM---EVDGDVEIPPNKAV-- 163

  Fly   154 PKPKWHAPWKLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLA---------------- 202
                         |:.||...|...|..|.::..|:|:||...:||:|:                
  Rat   164 -------------VLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGPTQLVLRHCI 215

  Fly   203 ---------------------------------------SGKLKLSLTGHVSTVRGVAVSTKHPY 228
                                                   .|.|..:|..|...:..:..:.|..:
  Rat   216 REGGQDVPSNKDVTSLDWNSEGTLLATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNF 280

  Fly   229 LFSCGEDRQVKCWD-----------------------------------------LEYNKVIRHY 252
            :.|.|.|:....||                                         |..::.|:.:
  Rat   281 ILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTF 345

  Fly   253 HGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNP------ 311
            .||.:.|.::...||.::||:...|.|.:||.|:....||.|..|...:.::....|.|      
  Rat   346 QGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPN 410

  Fly   312 ---QIITGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLHPSLYMFASASPDNIKQWRCPEGKF 373
               .:.:.|.||||||||:..|..:.|||.|::.|.|:..                   .|:|::
  Rat   411 ANLMLASASFDSTVRLWDVDRGICIHTLTKHQEPVYSVAF-------------------SPDGRY 456

  Fly   374 VQNISGHTSIVNCMAANSEGVLVSGGDNGTMFFWDWRTGYNFQRFQAPVQPGSMDSEAGIFAMCF 438
                                 |.||..:..:..|:.:||.....::         ...|||.:|:
  Rat   457 ---------------------LASGSFDKCVHIWNTQTGALVHSYR---------GTGGIFEVCW 491

  Fly   439 DQSGSRLITAEADKTIKV 456
            :.:|.::..:.:|.::.|
  Rat   492 NAAGDKVGASASDGSVCV 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 74/401 (18%)
WD40 164..458 CDD:238121 74/398 (19%)
WD40 repeat 177..212 CDD:293791 12/89 (13%)
WD40 repeat 218..254 CDD:293791 8/76 (11%)
WD40 repeat 259..295 CDD:293791 12/35 (34%)
WD40 repeat 302..337 CDD:293791 13/43 (30%)
WD40 repeat 343..378 CDD:293791 4/34 (12%)
WD40 repeat 386..426 CDD:293791 6/39 (15%)
WD40 repeat 433..457 CDD:293791 6/24 (25%)
Tbl1xr1NP_001102411.1 LisH 7..31 CDD:369916
WD40 164..470 CDD:238121 64/345 (19%)
WD40 repeat 172..215 CDD:293791 10/42 (24%)
WD40 repeat 228..264 CDD:293791 3/35 (9%)
WD40 repeat 270..306 CDD:293791 6/35 (17%)
WD40 repeat 311..346 CDD:293791 2/34 (6%)
WD40 repeat 353..388 CDD:293791 11/34 (32%)
WD40 repeat 394..439 CDD:293791 13/44 (30%)
WD40 repeat 445..483 CDD:293791 10/86 (12%)
WD40 repeat 486..509 CDD:293791 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.