DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and CG4935

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_609782.2 Gene:CG4935 / 34955 FlyBaseID:FBgn0028897 Length:308 Species:Drosophila melanogaster


Alignment Length:274 Identity:63/274 - (22%)
Similarity:105/274 - (38%) Gaps:28/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 GWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCGEDRQ 237
            |.||.:.......:..:...|:.||:|:.|||.|..:..||...|...|.|....|:.|...|:.
  Fly    18 GAVRAVRYNVDGTYCLSCGSDKKIKLWNPASGLLLKTYGGHADEVTDAAGSCDSSYIVSASLDKS 82

  Fly   238 VKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKA--NVHTLTGHTNT 300
            :..||:.....:|....|...|..:..:....:..:.|||:....||:||:.  .|..:....:.
  Fly    83 IIYWDVSTGAPVRRLRSHAGGVRCVCFNEDSSIAISGGRDNAVMCWDIRTRRLDPVQVMKEARDC 147

  Fly   301 VASVVAQATNP-QIITGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLHPSLY---------MF 355
            :.:|   |||. :|...|.|..||.:|:..|:..|          ..:..|..|         :.
  Fly   148 ITTV---ATNENRIYAASLDGCVRTYDIRVGELTC----------DKIGEPITYLAQTRDEQCLV 199

  Fly   356 ASASPDNIKQWRCPEGKFVQNISGHTS---IVNCMAANSEGVLVSGGDNGTMFFWDWRTGYNFQR 417
            |......::...|..|..:....||..   .:.|...:::..:|:|..:|..|.:|...|...||
  Fly   200 AGCQDSVVRLLDCETGGLLSEYRGHRGDDYHIECGILSNDAQIVTGSSDGDAFVYDLLDGKVLQR 264

  Fly   418 FQAPVQPGSMDSEA 431
            .:.....|.:.|.|
  Fly   265 IRISDNGGVVHSLA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 63/274 (23%)
WD40 164..458 CDD:238121 63/274 (23%)
WD40 repeat 177..212 CDD:293791 8/34 (24%)
WD40 repeat 218..254 CDD:293791 8/35 (23%)
WD40 repeat 259..295 CDD:293791 9/37 (24%)
WD40 repeat 302..337 CDD:293791 12/35 (34%)
WD40 repeat 343..378 CDD:293791 5/43 (12%)
WD40 repeat 386..426 CDD:293791 9/39 (23%)
WD40 repeat 433..457 CDD:293791
CG4935NP_609782.2 WD40 10..>302 CDD:225201 63/274 (23%)
WD40 10..281 CDD:238121 63/274 (23%)
WD40 repeat 21..57 CDD:293791 9/35 (26%)
WD40 repeat 62..98 CDD:293791 9/35 (26%)
WD40 repeat 105..135 CDD:293791 7/29 (24%)
WD40 repeat 140..178 CDD:293791 11/40 (28%)
WD40 repeat 186..222 CDD:293791 4/35 (11%)
WD40 repeat 229..254 CDD:293791 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.