| Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001382565.1 | Gene: | Wdr86 / 311956 | RGDID: | 1566180 | Length: | 380 | Species: | Rattus norvegicus |
| Alignment Length: | 337 | Identity: | 75/337 - (22%) |
|---|---|---|---|
| Similarity: | 125/337 - (37%) | Gaps: | 94/337 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 166 RVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVS--------------- 215
Fly 216 ----TVRGVAVST-------------------KHPYLFSCGEDRQVKCWDLEYNKVIRHYHGHLS 257
Fly 258 AVYSLALHPTID--------------VLATSGRDSTARIWDMRTKANVHTLTGHTNTVASVVAQA 308
Fly 309 TNPQIITGSHDSTVRLWDLAAGKS----------------------------------------V 333
Fly 334 CTLTNHKKSVRSIVLHPSLYMFASASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSEGVLVSG 398
Fly 399 GDNGTMFFWDWR 410 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 75/337 (22%) |
| WD40 | 164..458 | CDD:238121 | 75/337 (22%) | ||
| WD40 repeat | 177..212 | CDD:293791 | 7/34 (21%) | ||
| WD40 repeat | 218..254 | CDD:293791 | 9/54 (17%) | ||
| WD40 repeat | 259..295 | CDD:293791 | 11/49 (22%) | ||
| WD40 repeat | 302..337 | CDD:293791 | 14/74 (19%) | ||
| WD40 repeat | 343..378 | CDD:293791 | 4/34 (12%) | ||
| WD40 repeat | 386..426 | CDD:293791 | 8/25 (32%) | ||
| WD40 repeat | 433..457 | CDD:293791 | |||
| Wdr86 | NP_001382565.1 | WD40 | 8..301 | CDD:238121 | 62/292 (21%) |
| WD40 repeat | 19..55 | CDD:293791 | 7/35 (20%) | ||
| WD40 repeat | 101..135 | CDD:293791 | 6/33 (18%) | ||
| WD40 repeat | 140..190 | CDD:293791 | 11/49 (22%) | ||
| WD40 repeat | 197..232 | CDD:293791 | 11/34 (32%) | ||
| WD40 repeat | 239..272 | CDD:293791 | 3/32 (9%) | ||
| WD40 repeat | 278..312 | CDD:293791 | 4/34 (12%) | ||
| WD40 | 304..341 | CDD:197651 | 10/37 (27%) | ||
| WD40 repeat | 318..340 | CDD:293791 | 5/22 (23%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG53955 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||