DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and Tle6

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_006241089.2 Gene:Tle6 / 299637 RGDID:1561530 Length:546 Species:Rattus norvegicus


Alignment Length:274 Identity:58/274 - (21%)
Similarity:105/274 - (38%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 WKLSRVIS------GHL---------GWVR-CIAVEPGNEWFATGAGDRVIKIWDLASGKL--KL 208
            |.|...::      .||         |::| |:........||.|.....:.:||||:..|  |.
  Rat   283 WNLMSQVAEDRHPESHLQCDGVQPNRGYLRTCLLSSNSRTLFAGGYNLPGVFVWDLAARSLYEKY 347

  Fly   209 SLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLAT 273
            .|.....:.:.:| |||...:|:...|..|:.|||...:::|..:....|...|.:..  |.:..
  Rat   348 QLPCDGLSCQALA-STKENMVFAGFTDGTVRIWDLRTQEIVRDLNSPAGAAKCLVIKD--DSVWM 409

  Fly   274 SGRDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTN 338
            .|.|:..|.||:|. |.:.......:.:.|:....|...::.|..|....|::......|.|:..
  Rat   410 GGLDACLRCWDLRV-AKMSLEYPVQSQIMSLSHSVTEDWLLLGLADGQHCLFNSRERNQVLTVGT 473

  Fly   339 HKKSVRSIVLHPSLYMFASASPDNI----------KQWRCPEGKFVQNISGHTSIVNC--MAANS 391
            ..:::..:...|:...:.|...||:          |.::.||          .:.|.|  :..||
  Rat   474 KDQTILRLSFSPNGQWWVSVGMDNLITVHSMPMGAKLFQVPE----------AAAVRCFDITENS 528

  Fly   392 EGVLVSGGDNGTMF 405
            ..::...||..:::
  Rat   529 RLIVTGSGDCASIY 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 58/274 (21%)
WD40 164..458 CDD:238121 57/272 (21%)
WD40 repeat 177..212 CDD:293791 11/36 (31%)
WD40 repeat 218..254 CDD:293791 11/35 (31%)
WD40 repeat 259..295 CDD:293791 9/35 (26%)
WD40 repeat 302..337 CDD:293791 7/34 (21%)
WD40 repeat 343..378 CDD:293791 7/44 (16%)
WD40 repeat 386..426 CDD:293791 5/22 (23%)
WD40 repeat 433..457 CDD:293791
Tle6XP_006241089.2 WD40 251..538 CDD:421866 57/268 (21%)
WD40 repeat 252..306 CDD:293791 4/22 (18%)
WD40 repeat 311..348 CDD:293791 11/36 (31%)
WD40 repeat 355..391 CDD:293791 11/36 (31%)
WD40 repeat 398..429 CDD:293791 9/33 (27%)
WD40 repeat 436..470 CDD:293791 6/33 (18%)
WD40 repeat 478..501 CDD:293791 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.