| Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001339378.1 | Gene: | DCAF4 / 26094 | HGNCID: | 20229 | Length: | 496 | Species: | Homo sapiens |
| Alignment Length: | 333 | Identity: | 62/333 - (18%) |
|---|---|---|---|
| Similarity: | 103/333 - (30%) | Gaps: | 116/333 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 39 RLEKLRRSIKAKDGYGLVLDKVAKIGEARKASGAQTPGDKTLAITDGSATDAASGAGSLVKYNAG 103
Fly 104 ARPAEKTAPLVTGTHTSLVRASLANSNADMSANGAIASHLQL-------IPKKAPSIP------- 154
Fly 155 ------KP----------KWHAPWK------------------LSRVISGH-------------- 171
Fly 172 -------------LGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVS 223
Fly 224 TKHPYLFSCGEDRQVKCWDLEYNKVIRHYHGHLS--AVYSLALHPTIDVLATSGRDSTARIWDMR 286
Fly 287 TKANVHTL 294 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 36/181 (20%) |
| WD40 | 164..458 | CDD:238121 | 35/160 (22%) | ||
| WD40 repeat | 177..212 | CDD:293791 | 5/34 (15%) | ||
| WD40 repeat | 218..254 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 259..295 | CDD:293791 | 9/36 (25%) | ||
| WD40 repeat | 302..337 | CDD:293791 | |||
| WD40 repeat | 343..378 | CDD:293791 | |||
| WD40 repeat | 386..426 | CDD:293791 | |||
| WD40 repeat | 433..457 | CDD:293791 | |||
| DCAF4 | NP_001339378.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..66 | ||
| WD40 repeat | 286..323 | CDD:293791 | 6/36 (17%) | ||
| WD40 | <287..470 | CDD:330360 | 37/184 (20%) | ||
| WD40 repeat | 329..368 | CDD:293791 | 6/42 (14%) | ||
| WD 1 | 369..408 | 11/51 (22%) | |||
| WD40 repeat | 374..410 | CDD:293791 | 10/35 (29%) | ||
| WD 2 | 411..452 | 11/40 (28%) | |||
| WD40 repeat | 418..454 | CDD:293791 | 9/36 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||