| Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_588392.1 | Gene: | SPCC18.13 / 2539246 | PomBaseID: | SPCC18.13 | Length: | 421 | Species: | Schizosaccharomyces pombe |
| Alignment Length: | 257 | Identity: | 54/257 - (21%) |
|---|---|---|---|
| Similarity: | 84/257 - (32%) | Gaps: | 70/257 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 223 STKH--------PYL--FSC--GEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSG 275
Fly 276 RDSTARIWDMRTKANVHTL--------------TGHTNTV-----------------ASVVAQAT 309
Fly 310 NPQIITGSH---------DSTVRLWDLAAGKSVCTLT------NHKKSVRSIVLHPSLYMFASAS 359
Fly 360 PDNIKQWRCPEGKFVQNIS-GHTSIVNCMAANSEGVLVSGGDNGTMFFWDWRTGYNFQRFQA 420 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 54/257 (21%) |
| WD40 | 164..458 | CDD:238121 | 54/257 (21%) | ||
| WD40 repeat | 177..212 | CDD:293791 | |||
| WD40 repeat | 218..254 | CDD:293791 | 13/42 (31%) | ||
| WD40 repeat | 259..295 | CDD:293791 | 8/49 (16%) | ||
| WD40 repeat | 302..337 | CDD:293791 | 7/43 (16%) | ||
| WD40 repeat | 343..378 | CDD:293791 | 5/34 (15%) | ||
| WD40 repeat | 386..426 | CDD:293791 | 11/35 (31%) | ||
| WD40 repeat | 433..457 | CDD:293791 | |||
| SPCC18.13 | NP_588392.1 | WD40 | <20..90 | CDD:295369 | 18/69 (26%) |
| WD40 | <63..>267 | CDD:225201 | 41/211 (19%) | ||
| WD40 | 65..>260 | CDD:295369 | 39/205 (19%) | ||
| WD40 repeat | 66..104 | CDD:293791 | 8/37 (22%) | ||
| WD40 repeat | 109..144 | CDD:293791 | 4/34 (12%) | ||
| WD40 repeat | 152..222 | CDD:293791 | 14/77 (18%) | ||
| WD40 repeat | 229..264 | CDD:293791 | 12/37 (32%) | ||
| WD40 repeat | 272..323 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||