DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and WDFY3

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_005262915.1 Gene:WDFY3 / 23001 HGNCID:20751 Length:3544 Species:Homo sapiens


Alignment Length:341 Identity:74/341 - (21%)
Similarity:128/341 - (37%) Gaps:66/341 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HDLFVSNQGNLPEIDERLEKLRRSIKAKDGYGLVLDKVAKIGEARKASGAQTPGDKT-LAITDGS 86
            |.||...|.::..|::.| |...:|...:.:|.:..::.|.....|...::..||.. :::..||
Human  2950 HHLFYEGQVDIYNINDPL-KETATIGFINNFGQIPKQLFKKPHPPKRVRSRLNGDNAGISVLPGS 3013

  Fly    87 ATD-------------------AASGAGSLVKYNAGARPAEKTAPLVTGTHTSLVRASLANSNAD 132
            .:|                   .....|.:|..:.|....|:...|:..|...    :.|...||
Human  3014 TSDKIFFHHLDNLRPSLTPVKELKEPVGQIVCTDKGILAVEQNKVLIPPTWNK----TFAWGYAD 3074

  Fly   133 MSAN-GAIASHLQLIPKKAPSIPK--PKWHAPWKLSRVISGHLGWVRCIAVEPGNEWFATGAGDR 194
            :|.. |...|      .||.::.:  .:|              |.:.| |:.|..:...||....
Human  3075 LSCRLGTYES------DKAMTVYECLSEW--------------GQILC-AICPNPKLVITGGTST 3118

  Fly   195 VIKIWDLASGK-------LKLSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDLEYNKVIRHY 252
            |:.:|::.:.|       ||.:|.||..||.....|..:..:.|...||....|||.....:...
Human  3119 VVCVWEMGTSKEKAKTVTLKQALLGHTDTVTCATASLAYHIIVSGSRDRTCIIWDLNKLSFLTQL 3183

  Fly   253 HGHLSAVYSLALHP-TIDVLATSGRDSTARIWDMRTK--ANVHTLTGHTNTVASVVAQATNP--- 311
            .||.:.|.:|.::. |.|:::.:|  :...:|.:...  .:|:|.||.:..:........|.   
Human  3184 RGHRAPVSALCINELTGDIVSCAG--TYIHVWSINGNPIVSVNTFTGRSQQIICCCMSEMNEWDT 3246

  Fly   312 --QIITGSHDSTVRLW 325
              .|:||..|..||.|
Human  3247 QNVIVTGHSDGVVRFW 3262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 43/180 (24%)
WD40 164..458 CDD:238121 43/177 (24%)
WD40 repeat 177..212 CDD:293791 11/41 (27%)
WD40 repeat 218..254 CDD:293791 7/35 (20%)
WD40 repeat 259..295 CDD:293791 8/38 (21%)
WD40 repeat 302..337 CDD:293791 8/29 (28%)
WD40 repeat 343..378 CDD:293791
WD40 repeat 386..426 CDD:293791
WD40 repeat 433..457 CDD:293791
WDFY3XP_005262915.1 DUF4704 <1452..>1572 CDD:292415
PH_BEACH 2552..2675 CDD:275391
Beach 2713..2994 CDD:214982 10/44 (23%)
WD40 <3062..>3265 CDD:225201 53/228 (23%)
WD40 3102..>3264 CDD:295369 42/164 (26%)
WD40 repeat 3102..3143 CDD:293791 11/41 (27%)
WD40 repeat 3149..3185 CDD:293791 7/35 (20%)
WD40 repeat 3190..3227 CDD:293791 8/38 (21%)
WD40 repeat 3234..3273 CDD:293791 8/29 (28%)
FYVE_WDFY3 3467..3531 CDD:277259
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.