| Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001077396.1 | Gene: | Tle3 / 21887 | MGIID: | 104634 | Length: | 782 | Species: | Mus musculus |
| Alignment Length: | 381 | Identity: | 88/381 - (23%) |
|---|---|---|---|
| Similarity: | 140/381 - (36%) | Gaps: | 88/381 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 86 SATDAASGAGSLVKYNAGARPAEKTAPL-VTGTHTSLVRASLANSNADMSANGAIASHLQLIP-- 147
Fly 148 ---KKAPSIPKPKWHAPWKLSRVIS--GHLGWVRCIAV--EPGNEWFATGAGDRVIKIWDLASGK 205
Fly 206 LKLSLTGHVSTVRGVAVSTKHPYLFSC------------GEDRQVKCWDL--EYNKVIRHYHGHL 256
Fly 257 SAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDST 321
Fly 322 VRLWDLAAGK------------------------------SVCTLTNHKKSVRSIVLHPSLYM-- 354
Fly 355 --------FASASPDN-IKQWRCPEGKFVQNISGHTSIVNC-MAANSEGVLVSGGD 400 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 66/300 (22%) |
| WD40 | 164..458 | CDD:238121 | 66/297 (22%) | ||
| WD40 repeat | 177..212 | CDD:293791 | 9/36 (25%) | ||
| WD40 repeat | 218..254 | CDD:293791 | 8/49 (16%) | ||
| WD40 repeat | 259..295 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 302..337 | CDD:293791 | 11/64 (17%) | ||
| WD40 repeat | 343..378 | CDD:293791 | 11/45 (24%) | ||
| WD40 repeat | 386..426 | CDD:293791 | 4/16 (25%) | ||
| WD40 repeat | 433..457 | CDD:293791 | |||
| Tle3 | NP_001077396.1 | TLE_N | 9..143 | CDD:397828 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 140..173 | ||||
| GP domain. /evidence=ECO:0000250|UniProtKB:Q04724 | 142..209 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..357 | ||||
| CcN domain. /evidence=ECO:0000250|UniProtKB:Q04724 | 210..278 | ||||
| Nuclear localization signal. /evidence=ECO:0000255 | 235..238 | ||||
| Herpes_BLLF1 | <261..482 | CDD:282904 | 17/71 (24%) | ||
| SP domain. /evidence=ECO:0000250|UniProtKB:Q04724 | 279..462 | 15/51 (29%) | |||
| WD40 | 494..779 | CDD:238121 | 64/289 (22%) | ||
| WD 1 | 494..532 | 13/47 (28%) | |||
| WD40 repeat | 499..538 | CDD:293791 | 11/47 (23%) | ||
| WD 2 | 540..579 | 8/38 (21%) | |||
| WD40 repeat | 546..584 | CDD:293791 | 7/37 (19%) | ||
| WD 3 | 584..623 | 10/38 (26%) | |||
| WD40 repeat | 589..625 | CDD:293791 | 9/35 (26%) | ||
| WD 4 | 626..665 | 13/38 (34%) | |||
| WD40 repeat | 632..667 | CDD:293791 | 10/34 (29%) | ||
| WD 5 | 667..706 | 3/38 (8%) | |||
| WD40 repeat | 672..705 | CDD:293791 | 3/32 (9%) | ||
| WD 6 | 708..747 | 11/38 (29%) | |||
| WD40 repeat | 713..747 | CDD:293791 | 8/33 (24%) | ||
| WD 7 | 749..781 | 5/24 (21%) | |||
| WD40 repeat | 754..778 | CDD:293791 | 4/19 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||