| Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_496207.1 | Gene: | mec-15 / 174587 | WormBaseID: | WBGene00003177 | Length: | 406 | Species: | Caenorhabditis elegans |
| Alignment Length: | 268 | Identity: | 58/268 - (21%) |
|---|---|---|---|
| Similarity: | 102/268 - (38%) | Gaps: | 50/268 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 161 PWKLSRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTK 225
Fly 226 HPYLFSCGEDRQVKCW---------DLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTAR 281
Fly 282 IWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWD-----LAAGKSVCTLTN--- 338
Fly 339 -----HKKSVRSIVLHPSLYMFASASPDNIKQWRC---------------PEGKFVQNISGHTSI 383
Fly 384 VNCMAANS 391 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 58/268 (22%) |
| WD40 | 164..458 | CDD:238121 | 56/265 (21%) | ||
| WD40 repeat | 177..212 | CDD:293791 | 7/34 (21%) | ||
| WD40 repeat | 218..254 | CDD:293791 | 7/44 (16%) | ||
| WD40 repeat | 259..295 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 302..337 | CDD:293791 | 10/39 (26%) | ||
| WD40 repeat | 343..378 | CDD:293791 | 9/49 (18%) | ||
| WD40 repeat | 386..426 | CDD:293791 | 2/6 (33%) | ||
| WD40 repeat | 433..457 | CDD:293791 | |||
| mec-15 | NP_496207.1 | F-box-like | 9..52 | CDD:315592 | |
| WD40 | 88..322 | CDD:330360 | 40/184 (22%) | ||
| WD40 repeat | 106..154 | CDD:293791 | 2/6 (33%) | ||
| WD40 repeat | 162..197 | CDD:293791 | 8/41 (20%) | ||
| WD40 repeat | 204..241 | CDD:293791 | 5/36 (14%) | ||
| WD40 repeat | 247..286 | CDD:293791 | 10/40 (25%) | ||
| WD40 repeat | 290..310 | CDD:293791 | 5/20 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||