| Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_491069.1 | Gene: | copa-1 / 171860 | WormBaseID: | WBGene00022119 | Length: | 1232 | Species: | Caenorhabditis elegans |
| Alignment Length: | 305 | Identity: | 80/305 - (26%) |
|---|---|---|---|
| Similarity: | 123/305 - (40%) | Gaps: | 68/305 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 161 PWKLSRVISG------------------HLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLK 207
Fly 208 LSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLA 272
Fly 273 TSGRDSTARIWD---MRTK------------------------ANV-HTLTGHTNTVASVVAQAT 309
Fly 310 NPQIITGSHDSTVRLWDLAAGKS--VCTLTNHKKSVRSIVLHPSLYMFASASPD-NIKQWRCP-- 369
Fly 370 --------EGKFVQNISGHTSIVNCMAANSEGVLVSGGDNGTMFF 406 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 80/305 (26%) |
| WD40 | 164..458 | CDD:238121 | 78/302 (26%) | ||
| WD40 repeat | 177..212 | CDD:293791 | 8/34 (24%) | ||
| WD40 repeat | 218..254 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 259..295 | CDD:293791 | 16/63 (25%) | ||
| WD40 repeat | 302..337 | CDD:293791 | 10/36 (28%) | ||
| WD40 repeat | 343..378 | CDD:293791 | 10/45 (22%) | ||
| WD40 repeat | 386..426 | CDD:293791 | 7/21 (33%) | ||
| WD40 repeat | 433..457 | CDD:293791 | |||
| copa-1 | NP_491069.1 | WD40 | 7..317 | CDD:238121 | 79/301 (26%) |
| WD40 | 14..503 | CDD:225201 | 80/305 (26%) | ||
| WD40 repeat | 17..51 | CDD:293791 | 5/26 (19%) | ||
| WD40 repeat | 57..93 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 98..134 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 141..204 | CDD:293791 | 15/62 (24%) | ||
| WD40 repeat | 210..243 | CDD:293791 | 11/32 (34%) | ||
| WD40 repeat | 254..288 | CDD:293791 | 9/33 (27%) | ||
| Coatomer_WDAD | 341..770 | CDD:281977 | |||
| COPI_C | 820..1227 | CDD:284395 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||