DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and Rack1

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_032169.1 Gene:Rack1 / 14694 MGIID:101849 Length:317 Species:Mus musculus


Alignment Length:329 Identity:85/329 - (25%)
Similarity:126/329 - (38%) Gaps:88/329 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LSRVISGHLGWVRCIAVEPG-NEWFATGAGDRVIKIWDLAS-----GKLKLSLTGHVSTVRGVAV 222
            |...:.||.|||..||..|. .:...:.:.|:.|.:|.|..     |..:.:|.||...|..|.:
Mouse     7 LRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVI 71

  Fly   223 STKHPYLFSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGR-DSTARIWDMR 286
            |:          |.|                                 .|.||. |.|.|:||:.
Mouse    72 SS----------DGQ---------------------------------FALSGSWDGTLRLWDLT 93

  Fly   287 TKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLT----NHKKSVRSIV 347
            |........|||..|.||...:.|.||::||.|.|::||:..   .||..|    :|.:.|..:.
Mouse    94 TGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTL---GVCKYTVQDESHSEWVSCVR 155

  Fly   348 LHPSLYMFASASP-------DN-IKQWRCPEGKFVQNISGHTSIVNCMAANSEGVL-VSGGDNGT 403
            ..|:     |::|       |. :|.|.....|...|..|||..:|.:..:.:|.| .|||.:|.
Mouse   156 FSPN-----SSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQ 215

  Fly   404 MFFWDWRTGYNFQRFQAPVQPGSMDSEAGIFAMCFDQSGSRL-ITAEADKTIKVYKED-----DE 462
            ...||...|.:..         ::|....|.|:||  |.:|. :.|....:||::..:     ||
Mouse   216 AMLWDLNEGKHLY---------TLDGGDIINALCF--SPNRYWLCAATGPSIKIWDLEGKIIVDE 269

  Fly   463 ASEE 466
            ..:|
Mouse   270 LKQE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 82/314 (26%)
WD40 164..458 CDD:238121 82/314 (26%)
WD40 repeat 177..212 CDD:293791 9/40 (23%)
WD40 repeat 218..254 CDD:293791 4/35 (11%)
WD40 repeat 259..295 CDD:293791 9/36 (25%)
WD40 repeat 302..337 CDD:293791 13/34 (38%)
WD40 repeat 343..378 CDD:293791 9/42 (21%)
WD40 repeat 386..426 CDD:293791 9/40 (23%)
WD40 repeat 433..457 CDD:293791 9/24 (38%)
Rack1NP_032169.1 WD40 7..311 CDD:238121 85/329 (26%)
WD 1 13..44 10/30 (33%)
WD40 repeat 18..61 CDD:293791 10/42 (24%)
WD 2 61..91 13/72 (18%)
WD40 repeat 67..103 CDD:293791 13/78 (17%)
WD 3 103..133 14/29 (48%)
WD40 repeat 108..144 CDD:293791 15/38 (39%)
WD 4 146..178 7/36 (19%)
WD40 repeat 152..189 CDD:293791 8/41 (20%)
WD 5 190..220 10/29 (34%)
WD40 repeat 195..231 CDD:293791 10/44 (23%)
WD 6 231..260 10/30 (33%)
WD40 repeat 236..279 CDD:293791 12/40 (30%)
WD 7 281..311
WD40 repeat 286..310 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.