DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and AAMP

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_024308480.1 Gene:AAMP / 14 HGNCID:18 Length:459 Species:Homo sapiens


Alignment Length:306 Identity:59/306 - (19%)
Similarity:100/306 - (32%) Gaps:96/306 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 HLGWVRCIAVEPGNEWFA-TGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCGE 234
            |...|.|::::|.....| ||..|....:|.|:.|:|.....||..:|.....|.....:.:...
Human    90 HSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDM 154

  Fly   235 DRQVKCWDLEYNKVIRHYH-GHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHT 298
            ...:|.|.::..:.:..:. |.|.   .:..||...||.....|....:|.:.        .|..
Human   155 SGLLKVWQVDTKEEVWSFEAGDLE---WMEWHPRAPVLLAGTADGNTWMWKVP--------NGDC 208

  Fly   299 NTVASVVAQAT-------NPQIITGSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLHPSLYMFA 356
            .|.......||       ..:.:.|..|.|:|:|||..|                          
Human   209 KTFQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQG-------------------------- 247

  Fly   357 SASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSEGVLVSGGDNGTMFFWDWRTGYNFQRFQAP 421
              ||.::          ::...||...:.|:|||.:|.|                          
Human   248 --SPIHV----------LKGTEGHQGPLTCVAANQDGSL-------------------------- 274

  Fly   422 VQPGSMDSEAGIFAMCFDQSGSRLITAEADKTIKVYKEDDEASEES 467
            :..||:|.:|            :|::|...|.:.|::.:..||:.|
Human   275 ILTGSVDCQA------------KLVSATTGKVVGVFRPETVASQPS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 56/295 (19%)
WD40 164..458 CDD:238121 56/295 (19%)
WD40 repeat 177..212 CDD:293791 10/35 (29%)
WD40 repeat 218..254 CDD:293791 3/36 (8%)
WD40 repeat 259..295 CDD:293791 6/35 (17%)
WD40 repeat 302..337 CDD:293791 10/41 (24%)
WD40 repeat 343..378 CDD:293791 2/34 (6%)
WD40 repeat 386..426 CDD:293791 6/39 (15%)
WD40 repeat 433..457 CDD:293791 3/23 (13%)
AAMPXP_024308480.1 WD40 86..361 CDD:238121 59/306 (19%)
WD40 repeat 94..132 CDD:293791 11/37 (30%)
WD40 repeat 169..212 CDD:293791 10/53 (19%)
WD40 repeat 219..254 CDD:293791 11/72 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53955
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.