DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and AgaP_AGAP001361

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_321784.3 Gene:AgaP_AGAP001361 / 1281821 VectorBaseID:AGAP001361 Length:709 Species:Anopheles gambiae


Alignment Length:385 Identity:83/385 - (21%)
Similarity:145/385 - (37%) Gaps:85/385 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 KYNAGARPAEKTAPLVTGTHTSLVRASLANSNADMSANGAIASHLQLIPKKAPSIPKPKWHAPWK 163
            |.|.|.|...:.|.::........|            ||..|..|..|..:..|..:......|.
Mosquito     5 KNNQGGRKKMQVAFVIRDAEEKRHR------------NGVNALQLDSINGRLYSAGRDGIIRLWN 57

  Fly   164 LSRVISG---------HLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRG 219
            .::..|.         |..||..|.:..|.....:.:.|..:|:|:...|....:|..|...|:.
Mosquito    58 STQTSSSEPYIQSMEHHNDWVNDIVLCCGGRNLISASCDTTVKVWNAHKGFCMSTLRTHRDYVQA 122

  Fly   220 VAVSTKHPYLFSCGEDRQVKCWDLE-------YNKVI--RHYHGHLSAVYSLALHPTIDVLATSG 275
            :|.:.....:.|.|.|:.:..||:.       .|..:  ....|...::||||::|:..::.:..
Mosquito   123 LAYAKDREQVASAGLDKAIFLWDVNTLTALTASNNTVTTSSISGSKDSIYSLAMNPSGTIIVSGS 187

  Fly   276 RDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTNHK 340
            .::|.||||.||...:..|.|||..|.:::......|:::||.|..::||               
Mosquito   188 TENTLRIWDPRTCNKIAKLKGHTENVKALIVSEDGTQVVSGSSDGKIKLW--------------- 237

  Fly   341 KSVRSIVLHPSLYMFASASPDNIKQWRCPEGKFVQNISGHTSIVNCMAANSEGV--LVSGGDNGT 403
                                 :|.|.||     :|.||.|:..|.|:.. :||.  ::||..:..
Mosquito   238 ---------------------SIGQQRC-----IQTISVHSEGVWCLLM-TEGFSHVISGSRDRK 275

  Fly   404 MFFWDWRTGYNFQRFQAPVQPGSMDSEAGIFAMCF--DQSGSRLITAEAD-KTIKVYKED 460
            :...:.|...|....        .:.:|.:.:||:  ||:|....|..:| :..|::|.:
Mosquito   276 IIMTELRNPANSVLI--------CEEQAPVLSMCYNIDQTGVWATTWNSDIRCWKLHKTE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 70/319 (22%)
WD40 164..458 CDD:238121 69/316 (22%)
WD40 repeat 177..212 CDD:293791 7/34 (21%)
WD40 repeat 218..254 CDD:293791 7/44 (16%)
WD40 repeat 259..295 CDD:293791 12/35 (34%)
WD40 repeat 302..337 CDD:293791 6/34 (18%)
WD40 repeat 343..378 CDD:293791 5/34 (15%)
WD40 repeat 386..426 CDD:293791 7/41 (17%)
WD40 repeat 433..457 CDD:293791 8/26 (31%)
AgaP_AGAP001361XP_321784.3 WD40 <25..329 CDD:225201 78/365 (21%)
WD40 26..322 CDD:238121 76/357 (21%)
WD40 repeat 79..115 CDD:293791 7/35 (20%)
WD40 repeat 120..160 CDD:293791 8/39 (21%)
WD40 repeat 172..207 CDD:293791 12/34 (35%)
WD40 repeat 213..249 CDD:293791 12/76 (16%)
WD40 repeat 255..290 CDD:293791 8/35 (23%)
WD40 repeat 297..321 CDD:293791 7/23 (30%)
DUF3337 537..705 CDD:288649
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.