DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and AgaP_AGAP005429

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_315435.4 Gene:AgaP_AGAP005429 / 1276126 VectorBaseID:AGAP005429 Length:334 Species:Anopheles gambiae


Alignment Length:178 Identity:45/178 - (25%)
Similarity:77/178 - (43%) Gaps:30/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 SANGAIASHLQLIPKKAPSIPK---------PKWHAPWKLSRVISGHLGWVRCIAVEPGNEWFAT 189
            |.|.|.:..|:|  .:.|::|.         |.:...:....:|.|..|.: |     |.:| ::
Mosquito    43 SCNAADSPPLEL--DQLPTVPLQTLSVTDRCPIYSLSFHKDFLIVGLNGEI-C-----GFQW-SS 98

  Fly   190 GAGDRVIKIWDLASGKLKLSL---TGHVSTVRGVAVSTKHPYLFS-CGEDRQVKCWDLEYNKVIR 250
            .||....|.|     .:||..   :..:|.|..:.::.|...|:: || |..:....||..||.|
Mosquito    99 KAGTIGKKAW-----TVKLPAPPESADMSEVNYMWLNAKDDMLYAGCG-DNVLYGVSLEDGKVCR 157

  Fly   251 HYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHT 298
            .:|||...::.::  ..:..|||:..|.:..:||.|.|.:...:..||
Mosquito   158 EFHGHTDYIHCVS--GCVGKLATASEDGSVLLWDSRQKTSYAKIEPHT 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 37/142 (26%)
WD40 164..458 CDD:238121 37/139 (27%)
WD40 repeat 177..212 CDD:293791 9/37 (24%)
WD40 repeat 218..254 CDD:293791 10/36 (28%)
WD40 repeat 259..295 CDD:293791 8/35 (23%)
WD40 repeat 302..337 CDD:293791
WD40 repeat 343..378 CDD:293791
WD40 repeat 386..426 CDD:293791
WD40 repeat 433..457 CDD:293791
AgaP_AGAP005429XP_315435.4 WD40 11..>315 CDD:225201 45/178 (25%)
WD40 repeat 13..67 CDD:293791 7/25 (28%)
WD40 <18..248 CDD:295369 45/178 (25%)
WD40 repeat 73..117 CDD:293791 12/55 (22%)
WD40 repeat 125..160 CDD:293791 10/35 (29%)
WD40 repeat 166..208 CDD:293791 10/40 (25%)
WD40 repeat 216..253 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.