DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and CIAO1_ANOGA

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_310648.3 Gene:CIAO1_ANOGA / 1271794 VectorBaseID:AGAP000444 Length:341 Species:Anopheles gambiae


Alignment Length:295 Identity:76/295 - (25%)
Similarity:131/295 - (44%) Gaps:53/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 WKLSRVIS-GHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLT--GHVSTVRGVAVS 223
            |....|:: ||...:|.:|......:.|:.:.|..:.:||..||:.:.:.|  ||.:.|:.|..|
Mosquito    49 WVAQTVLTDGHTRTIRELAWSCCGHYLASASFDTTVAVWDKKSGEFECNATLEGHDNEVKSVTWS 113

  Fly   224 TKHPYLFSCGEDRQVKCWDL--------EYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTA 280
            .....|.:|..|:.|..|::        || :.:...:||...|..:..||..|:||::..|:|.
Mosquito   114 RSGNLLATCSRDKSVWIWEIHHAPDQEDEY-ECVAVLNGHTQDVKKVCWHPQEDLLASASYDNTI 177

  Fly   281 RI---------WDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLW-----DLAAG- 330
            |:         |:|     :..|..|::||.|:...||..::.:.|.|:||::|     |.|.| 
Mosquito   178 RMYRQDLADSEWEM-----LEPLESHSSTVWSISFDATGQRLASCSEDTTVKVWQQYGPDNALGI 237

  Fly   331 ---------KSVCTLTN-HKKSVRSIVLHPSLYMFASA-SPDNIKQWR--------CPEGKFVQN 376
                     |.||||:. |.:||..|.......:.|:| ..|.::.:|        .|..:.|..
Mosquito   238 PCPDRGTIWKCVCTLSGYHSRSVYDIDWCKQTGLLATACGDDTVRIFREASDSDRNEPTFELVVT 302

  Fly   377 ISGHTSIVNCMA--ANSEGVLVSGGDNGTMFFWDW 409
            :..|:...|.:|  ....|:|::..|:|.:..|.:
Mosquito   303 VEAHSQDANKVAWHPTVPGLLLTASDDGEIKLWQY 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 76/295 (26%)
WD40 164..458 CDD:238121 75/293 (26%)
WD40 repeat 177..212 CDD:293791 8/36 (22%)
WD40 repeat 218..254 CDD:293791 9/43 (21%)
WD40 repeat 259..295 CDD:293791 11/44 (25%)
WD40 repeat 302..337 CDD:293791 15/49 (31%)
WD40 repeat 343..378 CDD:293791 8/43 (19%)
WD40 repeat 386..426 CDD:293791 6/26 (23%)
WD40 repeat 433..457 CDD:293791
CIAO1_ANOGAXP_310648.3 WD40 <2..335 CDD:225201 75/291 (26%)
WD40 6..336 CDD:238121 75/292 (26%)
WD40 repeat 17..58 CDD:293791 2/8 (25%)
WD40 repeat 64..102 CDD:293791 9/37 (24%)
WD40 repeat 107..150 CDD:293791 10/43 (23%)
WD40 repeat 157..196 CDD:293791 10/43 (23%)
WD40 repeat 202..253 CDD:293791 16/50 (32%)
WD40 repeat 260..304 CDD:293791 8/43 (19%)
WD40 repeat 311..335 CDD:293791 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.