DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and BOP1_ANOGA

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_308633.4 Gene:BOP1_ANOGA / 1269978 VectorBaseID:AGAP007128 Length:865 Species:Anopheles gambiae


Alignment Length:410 Identity:79/410 - (19%)
Similarity:142/410 - (34%) Gaps:145/410 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LIPKKAPSIPKPKWHAPWKL--SRVISGHLGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGK-L 206
            ||||    :|.|:...|:..  :.:.:||...:|||:|||..|:..||:.|..:|||::::.: :
Mosquito   503 LIPK----LPSPRDLQPFPTLQNLIYTGHTSLIRCISVEPKGEYIVTGSDDMTVKIWEISTARCI 563

  Fly   207 KLSLTGHVSTVRGV------------AVSTKHPYLFS--CGEDRQVKCWD--------------- 242
            :...||.:  ||.|            |.|.|...|.:  .|:...||..|               
Mosquito   564 RTIPTGDI--VRSVAWCPNSKISLVAAASGKRVLLINPKVGDYMLVKKTDDLLTEAPRSDTVDSE 626

  Fly   243 -----LEYNKV--------IRHYHGHLSAVYSLALHPTIDVLAT---------------SGRDST 279
                 :::.:|        :|....|...|..:..|...|..||               |.|.|.
Mosquito   627 RIRSAVQWGEVTEEEKKLGVRIVITHFREVRQVTWHGRGDYFATVMPDGAYRSVMIHQLSKRRSQ 691

  Fly   280 A-----------------------------RIWDMRTKANVHTLTGHTNTVASVVAQATNPQIIT 315
            .                             |::|:..:..:..|......::|:........::.
Mosquito   692 VPFSKSKGLIQCVLFHPIKPCLFVATQRHIRVYDLVKQLMMKKLYPGCKWISSMAIHPKGDNLLI 756

  Fly   316 GSHDSTVRLWDL-AAGKSVCTLTNHKKSVRSIVLHPSLYMFASASPDNIKQWRCPEGKFVQNISG 379
            |:::..:..:|| .:.|....|..|..::||:..||...:||||..|                  
Mosquito   757 GTYEKRLMWFDLDLSTKPYQQLRIHNAAIRSVAFHPRYPLFASAGDD------------------ 803

  Fly   380 HTSIVNCMAANSEGVLVSGGDNGTMFFWDWRTGYNFQRFQAP-------VQPGSMDSEAGIFAMC 437
                        ..|:||.|           ..|| ...|.|       ::..::.::..:|.:.
Mosquito   804 ------------RSVIVSHG-----------MVYN-DLLQNPLIVPLRRLKNHAVVNDFSVFDVV 844

  Fly   438 FDQSGSRLITAEADKTIKVY 457
            |..:...:.::.||.|:::|
Mosquito   845 FHPTQPWVFSSGADNTVRLY 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 73/394 (19%)
WD40 164..458 CDD:238121 72/391 (18%)
WD40 repeat 177..212 CDD:293791 12/35 (34%)
WD40 repeat 218..254 CDD:293791 12/77 (16%)
WD40 repeat 259..295 CDD:293791 10/79 (13%)
WD40 repeat 302..337 CDD:293791 5/35 (14%)
WD40 repeat 343..378 CDD:293791 9/34 (26%)
WD40 repeat 386..426 CDD:293791 8/46 (17%)
WD40 repeat 433..457 CDD:293791 5/23 (22%)
BOP1_ANOGAXP_308633.4 Ribosomal_L24e_L24 <7..77 CDD:294589
BOP1NT 252..517 CDD:214986 7/17 (41%)
WD40 517..>864 CDD:225201 71/390 (18%)
WD40 524..864 CDD:295369 71/383 (19%)
WD40 repeat 533..568 CDD:293791 12/34 (35%)
WD40 repeat 573..651 CDD:293791 12/77 (16%)
WD40 repeat 656..694 CDD:293791 8/37 (22%)
WD40 repeat 702..737 CDD:293791 3/34 (9%)
WD40 repeat 742..779 CDD:293791 5/36 (14%)
WD40 repeat 785..833 CDD:293791 17/89 (19%)
WD40 repeat 840..864 CDD:293791 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.