DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and Tle7

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001357768.1 Gene:Tle7 / 102638837 MGIID:5439433 Length:430 Species:Mus musculus


Alignment Length:236 Identity:41/236 - (17%)
Similarity:81/236 - (34%) Gaps:79/236 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 GKLKLSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWD--------------LEY----NKVIR 250
            |..::....|...|..:|:|:...::::||.. .::.||              |::    |:|: 
Mouse   137 GSWRVGTLRHGKRVNAIAISSAPCHVYTCGTG-YIRVWDENALHASDRAPQAQLDFQDPRNRVL- 199

  Fly   251 HYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNPQIIT 315
                      :..|.|....|.|.|......:||:.....|......|.::...:|.:::..:..
Mouse   200 ----------TCKLFPDEQSLITGGMARGLTLWDLAPTPQVRAQMASTGSICYSLALSSDAHLCL 254

  Fly   316 GSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLHPSLYMFASASPD--NIKQWRCPEGKFVQNIS 378
            .|....|.:||:          .::..:|...:.|    :||...|  ..|.|            
Mouse   255 ASFKGFVEIWDV----------QNQILIRKHEVPP----YASRCVDITGFKFW------------ 293

  Fly   379 GHTSIVNCMAANSEGVLVSGGDNGTMFFWDWRTGYNFQRFQ 419
                              :||::.|::.||.|   ::|:.|
Mouse   294 ------------------TGGEDTTLYSWDLR---SYQKLQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 41/236 (17%)
WD40 164..458 CDD:238121 41/236 (17%)
WD40 repeat 177..212 CDD:293791 1/7 (14%)
WD40 repeat 218..254 CDD:293791 9/53 (17%)
WD40 repeat 259..295 CDD:293791 8/35 (23%)
WD40 repeat 302..337 CDD:293791 5/34 (15%)
WD40 repeat 343..378 CDD:293791 7/36 (19%)
WD40 repeat 386..426 CDD:293791 8/34 (24%)
WD40 repeat 433..457 CDD:293791
Tle7NP_001357768.1 WD40 <146..422 CDD:225201 40/227 (18%)
WD40 repeat 152..191 CDD:293791 7/39 (18%)
WD40 repeat 199..236 CDD:293791 8/47 (17%)
WD40 repeat 241..275 CDD:293791 6/43 (14%)
WD40 repeat 283..316 CDD:293791 11/64 (17%)
WD40 repeat 321..361 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.