DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and cdc20b

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_004910413.1 Gene:cdc20b / 100497347 XenbaseID:XB-GENE-1013871 Length:519 Species:Xenopus tropicalis


Alignment Length:259 Identity:56/259 - (21%)
Similarity:104/259 - (40%) Gaps:40/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 LGWV---RCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCG 233
            :.|:   .|:|:       .|.:|:  :::||:.:.|...::.||:|.|.  |:|..:..|.|..
 Frog   278 VSWISSGTCLAI-------GTSSGE--VQLWDIETQKRLRNMLGHMSVVG--ALSWNNHILSSGS 331

  Fly   234 EDRQVKCWDLEYNKVIRHYHG---HLSAVYSLALHPTIDVLATSGRDSTARIWDM---RTKANVH 292
            ....:...|:   ::..|:.|   |...:.||...|..:.||:...|...:||..   .||....
 Frog   332 RLGHIHHHDV---RIAEHHIGTLQHKQGICSLKWSPCGNKLASGSSDGDLKIWPCDPGETKLKSP 393

  Fly   293 TLTGHTNTVASVVAQATN--PQIIT------GSHDSTVRLWDLAAGKSVCTLTNHKKSVRSIVLH 349
            .|    |.......:|.|  |.:..      |..|..:|:||..:||::.: .|....:.|::..
 Frog   394 LL----NMPHPTAVKAMNWCPWLSDTLAVGGGMTDGLIRIWDTNSGKNIHS-ANTNSQICSLLWL 453

  Fly   350 P---SLYMFASASPDNIKQWRCPEGKFVQNISGHTS-IVNCMAANSEGVLVSGGDNGTMFFWDW 409
            |   .|......|.:.:..|:.|....:.:..||.. :::...:..:..:.|...|||...|.:
 Frog   454 PQTKELLTGHGPSRNQMTIWQYPSLLKMNDYYGHKGRVLHLALSPDQRRIFSAAANGTANIWKY 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 56/259 (22%)
WD40 164..458 CDD:238121 56/259 (22%)
WD40 repeat 177..212 CDD:293791 7/34 (21%)
WD40 repeat 218..254 CDD:293791 6/35 (17%)
WD40 repeat 259..295 CDD:293791 10/38 (26%)
WD40 repeat 302..337 CDD:293791 10/42 (24%)
WD40 repeat 343..378 CDD:293791 6/37 (16%)
WD40 repeat 386..426 CDD:293791 5/24 (21%)
WD40 repeat 433..457 CDD:293791
cdc20bXP_004910413.1 WD40 <220..516 CDD:225201 55/256 (21%)
WD40 repeat 234..270 CDD:293791
WD40 repeat 275..312 CDD:293791 8/42 (19%)
WD40 repeat 318..349 CDD:293791 6/35 (17%)
WD40 repeat 357..396 CDD:293791 11/42 (26%)
WD40 repeat 404..440 CDD:293791 10/35 (29%)
WD40 repeat 447..485 CDD:293791 6/37 (16%)
WD40 repeat 491..517 CDD:293791 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.