DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango4 and LOC100490380

DIOPT Version :9

Sequence 1:NP_572778.1 Gene:Tango4 / 32168 FlyBaseID:FBgn0030365 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_004912816.1 Gene:LOC100490380 / 100490380 -ID:- Length:399 Species:Xenopus tropicalis


Alignment Length:228 Identity:49/228 - (21%)
Similarity:81/228 - (35%) Gaps:66/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 SAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDST 321
            :||.::|.||:.|:||....|....::                                     :
 Frog    48 AAVNTIAFHPSQDILAAGDVDGDVFVY-------------------------------------S 75

  Fly   322 VRLWDLAAGKSVCTLTNHKKSVR-SIVLHPSLYMFASASPDNIKQWRCPEGKFVQNI-SGHTSIV 384
            ...|: :..|.:.:..:|.||.| |........:|..:....|......|||.::.| ..|.|.:
 Frog    76 YSCWE-SGNKELWSSGHHLKSCRDSAFTSDGQQLFTVSKDKAIHILSMEEGKLIKRIPKAHDSPL 139

  Fly   385 NCMAANSEGVLVSGGDNGTMFFWDWRTGYNFQRFQAPVQPGSMDSEAGIFAMCFDQSGSRLITAE 449
            ||:....|.:..:|.|||.:..||.|...:|...:        :.|..|..|..|::...|:||.
 Frog   140 NCLLLIDENLFATGDDNGMLKVWDLRRDTSFMEMK--------NHEEYISDMAIDENKKMLLTAS 196

  Fly   450 ADKTIKVYKEDDEASEESHPINWRPDLLKRRKF 482
            .|.|:.|:.                  :|||:|
 Frog   197 GDGTMGVFN------------------IKRRRF 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango4NP_572778.1 WD40 <161..458 CDD:225201 45/202 (22%)
WD40 164..458 CDD:238121 45/202 (22%)
WD40 repeat 177..212 CDD:293791
WD40 repeat 218..254 CDD:293791
WD40 repeat 259..295 CDD:293791 8/35 (23%)
WD40 repeat 302..337 CDD:293791 2/34 (6%)
WD40 repeat 343..378 CDD:293791 8/36 (22%)
WD40 repeat 386..426 CDD:293791 10/39 (26%)
WD40 repeat 433..457 CDD:293791 8/23 (35%)
LOC100490380XP_004912816.1 WD40 47..332 CDD:392136 49/228 (21%)
WD40 repeat 51..88 CDD:293791 9/74 (12%)
WD40 repeat 98..133 CDD:293791 7/34 (21%)
WD40 repeat 139..175 CDD:293791 11/43 (26%)
WD40 repeat 180..215 CDD:293791 13/50 (26%)
WD40 repeat 223..264 CDD:293791
WD40 repeat 271..299 CDD:293791
WD40 repeat 307..333 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.