| Sequence 1: | NP_572778.1 | Gene: | Tango4 / 32168 | FlyBaseID: | FBgn0030365 | Length: | 482 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001083011.1 | Gene: | cop1 / 100037391 | ZFINID: | ZDB-GENE-070410-134 | Length: | 694 | Species: | Danio rerio |
| Alignment Length: | 325 | Identity: | 67/325 - (20%) |
|---|---|---|---|
| Similarity: | 119/325 - (36%) | Gaps: | 81/325 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 200 DLASGKLKLSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDLEYNKVIR-----HY------- 252
Fly 253 HGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNPQII-TG 316
Fly 317 SHDSTVRLW---------DLAAGKSVC------------------------TLTNHKKSVRSIVL 348
Fly 349 HPSLYMFA---------SASPDN-IKQWRCPEGKFVQNISGHTSIVNCMAANSEGVLVS-GGDNG 402
Fly 403 TMFFW-----DWRTGYNFQRFQAPVQPGSMDSEAGIF--AMCF----DQSGSRLITAEADKTIKV 456
Fly 457 456 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tango4 | NP_572778.1 | WD40 | <161..458 | CDD:225201 | 67/325 (21%) |
| WD40 | 164..458 | CDD:238121 | 67/325 (21%) | ||
| WD40 repeat | 177..212 | CDD:293791 | 3/11 (27%) | ||
| WD40 repeat | 218..254 | CDD:293791 | 9/47 (19%) | ||
| WD40 repeat | 259..295 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 302..337 | CDD:293791 | 12/68 (18%) | ||
| WD40 repeat | 343..378 | CDD:293791 | 8/44 (18%) | ||
| WD40 repeat | 386..426 | CDD:293791 | 6/45 (13%) | ||
| WD40 repeat | 433..457 | CDD:293791 | 11/30 (37%) | ||
| cop1 | NP_001083011.1 | zf-C3HC4 | 98..135 | CDD:278524 | |
| NAM-associated | <200..260 | CDD:291001 | |||
| WD40 | 384..690 | CDD:238121 | 62/318 (19%) | ||
| WD40 repeat | 387..418 | CDD:293791 | 7/32 (22%) | ||
| WD40 repeat | 436..473 | CDD:293791 | 9/38 (24%) | ||
| WD40 repeat | 480..516 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 521..559 | CDD:293791 | 5/37 (14%) | ||
| WD40 repeat | 565..600 | CDD:293791 | 7/34 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||