DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-16 and SPCC16C4.22

DIOPT Version :9

Sequence 1:NP_001285148.1 Gene:Chrac-16 / 32166 FlyBaseID:FBgn0043001 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001343092.1 Gene:SPCC16C4.22 / 9406966 PomBaseID:SPCC16C4.22 Length:87 Species:Schizosaccharomyces pombe


Alignment Length:77 Identity:30/77 - (38%)
Similarity:42/77 - (54%) Gaps:3/77 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ETFLPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAY-TEEFGQRPGEALKYEHLS 80
            :|.||||||:.|:|...|....:|....|::..|||||..||..|| ..:..:|.|  ::|..:.
pombe     7 KTVLPLSRVKRIIKQDEDVHYCSNASALLISVATELFVEKLATEAYQLAKLQKRKG--IRYRDVE 69

  Fly    81 QVVNKNKNLEFL 92
            .||.|:...|||
pombe    70 DVVRKDDQFEFL 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-16NP_001285148.1 CBFD_NFYB_HMF 19..83 CDD:366318 23/64 (36%)
SPCC16C4.22NP_001343092.1 BUR6 <10..>86 CDD:333362 29/74 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2069
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.