DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-16 and Chrac1

DIOPT Version :9

Sequence 1:NP_001285148.1 Gene:Chrac-16 / 32166 FlyBaseID:FBgn0043001 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_444298.1 Gene:Chrac1 / 93696 MGIID:2135796 Length:129 Species:Mus musculus


Alignment Length:106 Identity:43/106 - (40%)
Similarity:62/106 - (58%) Gaps:1/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVN 84
            |||||:|.|||||.:...|..|.|.|..|.|||||::||..:|....| :..:||.|..|:....
Mouse    19 LPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQYLATCSYRHGSG-KAKKALTYSDLASTAE 82

  Fly    85 KNKNLEFLLQIVPQKIRVHQFQEMLRLNRSAGSDDDDDDDD 125
            .::.|:||..|:|:||...::.:||:..|....|::||..|
Mouse    83 DSETLQFLADILPKKILASKYLKMLKEKREEEEDNEDDGSD 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-16NP_001285148.1 CBFD_NFYB_HMF 19..83 CDD:366318 29/62 (47%)
Chrac1NP_444298.1 H4 18..79 CDD:304892 29/60 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..129 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11536
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5219
Isobase 1 0.950 - 0 Normalized mean entropy S2112
OMA 1 1.010 - - QHG45508
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 1 1.000 - - FOG0007214
OrthoInspector 1 1.000 - - oto94773
orthoMCL 1 0.900 - - OOG6_104378
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 1 1.000 - - X6087
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.820

Return to query results.
Submit another query.