DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-16 and DPB3

DIOPT Version :9

Sequence 1:NP_001285148.1 Gene:Chrac-16 / 32166 FlyBaseID:FBgn0043001 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_009837.1 Gene:DPB3 / 852580 SGDID:S000000482 Length:201 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:33/142 - (23%)
Similarity:56/142 - (39%) Gaps:16/142 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ERPPTAETFLPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEA-- 73
            |:.|.    .|:|:|:.|.|...:..:.:|..:.......||||::|...:.........|:.  
Yeast     7 EKAPV----FPISKVKKIAKCDPEYVITSNVAISATAFAAELFVQNLVEESLVLAQLNSKGKTSL 67

  Fly    74 -LKYEHLSQVVNKNKNLEFLLQIVPQKIRVHQFQEMLRLNRSAGSDDDD---------DDDDDDD 128
             |....:.:.|.|..|..||...:.|..:.....:...||...|..|.:         :||..::
Yeast    68 RLSLNSIEECVEKRDNFRFLEDAIKQLKKNSALDKKRELNMQPGRSDQEVVIEEPELHEDDGVEE 132

  Fly   129 EEESESESESDE 140
            |||.:..||.:|
Yeast   133 EEEEDEVSEEEE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-16NP_001285148.1 CBFD_NFYB_HMF 19..83 CDD:366318 13/66 (20%)
DPB3NP_009837.1 BUR6 <12..89 CDD:227572 18/76 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344177
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104378
Panther 1 1.100 - - O PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.