DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-16 and NF-YC10

DIOPT Version :9

Sequence 1:NP_001285148.1 Gene:Chrac-16 / 32166 FlyBaseID:FBgn0043001 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_563803.1 Gene:NF-YC10 / 837313 AraportID:AT1G07980 Length:206 Species:Arabidopsis thaliana


Alignment Length:86 Identity:28/86 - (32%)
Similarity:49/86 - (56%) Gaps:1/86 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AETFLPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLS 80
            |:...|::|:|.||:|......|..:.:||:.|.||:|:...:..||......:. :.:.|:|||
plant   106 AKIKFPMNRIRRIMRSDNSAPQIMQDAVFLVNKATEMFIERFSEEAYDSSVKDKK-KFIHYKHLS 169

  Fly    81 QVVNKNKNLEFLLQIVPQKIR 101
            .||:.::..|||...||:|::
plant   170 SVVSNDQRYEFLADSVPEKLK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-16NP_001285148.1 CBFD_NFYB_HMF 19..83 CDD:366318 19/63 (30%)
NF-YC10NP_563803.1 CBFD_NFYB_HMF 108..172 CDD:395650 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007214
OrthoInspector 1 1.000 - - oto3330
orthoMCL 1 0.900 - - OOG6_104378
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.