DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-16 and CHRAC1

DIOPT Version :9

Sequence 1:NP_001285148.1 Gene:Chrac-16 / 32166 FlyBaseID:FBgn0043001 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_059140.1 Gene:CHRAC1 / 54108 HGNCID:13544 Length:131 Species:Homo sapiens


Alignment Length:115 Identity:42/115 - (36%)
Similarity:68/115 - (59%) Gaps:2/115 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVN 84
            |||||:|.|||||.:...|..|.|.|..|.|||||:.||..:|....|:.. :.|.|..|:....
Human    19 LPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEK-KVLTYSDLANTAQ 82

  Fly    85 KNKNLEFLLQIVPQKIRVHQFQEMLRLNRSAGSDDDDDDDDDDDEEESES 134
            :::..:||..|:|:||...::.:||: ......|:::|:|::.|.:|::|
Human    83 QSETFQFLADILPKKILASKYLKMLK-EEKREEDEENDNDNESDHDEADS 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-16NP_001285148.1 CBFD_NFYB_HMF 19..83 CDD:366318 28/62 (45%)
CHRAC1NP_059140.1 BUR6 <15..>97 CDD:333362 32/78 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..131 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5259
Isobase 1 0.950 - 0 Normalized mean entropy S2112
OMA 1 1.010 - - QHG45508
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 1 1.000 - - FOG0007214
OrthoInspector 1 1.000 - - oto91190
orthoMCL 1 0.900 - - OOG6_104378
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 1 1.000 - - X6087
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.