DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-16 and chrac1

DIOPT Version :9

Sequence 1:NP_001285148.1 Gene:Chrac-16 / 32166 FlyBaseID:FBgn0043001 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001013311.1 Gene:chrac1 / 503606 ZFINID:ZDB-GENE-050227-18 Length:114 Species:Danio rerio


Alignment Length:118 Identity:43/118 - (36%)
Similarity:65/118 - (55%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VERPPTAETF-LPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEA 73
            |::...:.|. ||:||||.|||||.|...|..:.|||.||.|||||:|||.::| |....:....
Zfish     5 VDQAANSRTISLPISRVRLIMKSSPDVSCINQDALFLTTKATELFVQHLALSSY-ENGPSKDTNT 68

  Fly    74 LKYEHLSQVVNKNKNLEFLLQIVPQKIRVHQFQEMLRLNRSAGSDDDDDDDDD 126
            |.|..|:..|.:.:..:||..|:|:||....:.:.|        ::.:.:||:
Zfish    69 LSYSDLADTVEETETFQFLTDILPKKILARDYLKTL--------EEMEKEDDN 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-16NP_001285148.1 CBFD_NFYB_HMF 19..83 CDD:366318 31/64 (48%)
chrac1NP_001013311.1 H4 15..75 CDD:304892 30/60 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582157
Domainoid 1 1.000 56 1.000 Domainoid score I11056
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5277
OMA 1 1.010 - - QHG45508
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 1 1.000 - - FOG0007214
OrthoInspector 1 1.000 - - oto41247
orthoMCL 1 0.900 - - OOG6_104378
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 1 1.000 - - X6087
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.