DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-16 and Pole4

DIOPT Version :9

Sequence 1:NP_001285148.1 Gene:Chrac-16 / 32166 FlyBaseID:FBgn0043001 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001102104.1 Gene:Pole4 / 362385 RGDID:1307793 Length:118 Species:Rattus norvegicus


Alignment Length:90 Identity:27/90 - (30%)
Similarity:45/90 - (50%) Gaps:4/90 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSQPPVERPPTAE-TFLPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAY-TEEFG 67
            ::|.|...|..|. :.|||:||:.::|:..|..|...|.:|::.:..||||..:|..|| ..:.|
  Rat    26 QAQAPTNAPGGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQG 90

  Fly    68 QRPGEALKYEHLSQVVNKNKNLEFL 92
            :|  :.|:...|...:.......||
  Rat    91 KR--KTLQRRDLDNAIEAVDEFAFL 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-16NP_001285148.1 CBFD_NFYB_HMF 19..83 CDD:366318 21/64 (33%)
Pole4NP_001102104.1 H4 41..104 CDD:304892 21/64 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.