DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-16 and php5

DIOPT Version :9

Sequence 1:NP_001285148.1 Gene:Chrac-16 / 32166 FlyBaseID:FBgn0043001 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_596412.1 Gene:php5 / 2540133 PomBaseID:SPBC3B8.02 Length:415 Species:Schizosaccharomyces pombe


Alignment Length:80 Identity:24/80 - (30%)
Similarity:45/80 - (56%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LPLSRVRTIMKSSMD--TGLITNEVLFLMTKCTELFVRHLAGAAYTE-EFGQRPGEALKYEHLSQ 81
            |||:|::.:||:..|  ..:|:.|..||..|.:|:|:..|...|:.. :..||  ..|:...::.
pombe   109 LPLARIKKVMKTDDDVKNKMISAEAPFLFAKGSEIFIAELTMRAWLHAKKNQR--RTLQRSDIAN 171

  Fly    82 VVNKNKNLEFLLQIV 96
            .|:|::..:||:.|:
pombe   172 AVSKSEMYDFLIDII 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-16NP_001285148.1 CBFD_NFYB_HMF 19..83 CDD:366318 19/65 (29%)
php5NP_596412.1 HAP5 1..287 CDD:227533 24/80 (30%)
CBFD_NFYB_HMF 109..173 CDD:279185 19/65 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.