DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-16 and rpoa-49

DIOPT Version :9

Sequence 1:NP_001285148.1 Gene:Chrac-16 / 32166 FlyBaseID:FBgn0043001 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001293501.1 Gene:rpoa-49 / 24104475 WormBaseID:WBGene00017749 Length:432 Species:Caenorhabditis elegans


Alignment Length:140 Identity:28/140 - (20%)
Similarity:45/140 - (32%) Gaps:51/140 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPTAETFL-----PLSRVRTIMKSSMDTGLITNEVLFLMTK------------CTELFVRHLAGA 60
            ||..:|.|     |:|    :....::...|.:....||.|            |..|.:      
 Worm   217 PPAVQTELSRDIYPIS----LFLEDIEIDAIESIATELMEKKKKEKLEAGIPECVTLIM------ 271

  Fly    61 AYTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQ----------IVPQKIRVHQFQ--------- 106
             |.|:..||....|....:.:::.|......||:          |:.||::...|.         
 Worm   272 -YNEKTKQRAAAYLLLSTMIEILTKMGKQRQLLRKDLSELKMPDILRQKVQAQFFNDSTNEKGYT 335

  Fly   107 ----EMLRLN 112
                |.:|||
 Worm   336 GRGAERIRLN 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-16NP_001285148.1 CBFD_NFYB_HMF 19..83 CDD:366318 14/80 (18%)
rpoa-49NP_001293501.1 RNA_pol_I_A49 44..426 CDD:284324 28/140 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.