DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-16 and pole-4

DIOPT Version :9

Sequence 1:NP_001285148.1 Gene:Chrac-16 / 32166 FlyBaseID:FBgn0043001 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_497087.1 Gene:pole-4 / 175152 WormBaseID:WBGene00013150 Length:179 Species:Caenorhabditis elegans


Alignment Length:130 Identity:34/130 - (26%)
Similarity:64/130 - (49%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LPLSRVRTIMKSSMDTGLITNEVLFLMTKCTELFVRHLAGAAYTEEFGQRPGEALKYEHLSQVVN 84
            |||.||:.:::.:.|..::.||.|.||.|..|||::.|:.|| .:.......:.::.:.:.:.:.
 Worm    36 LPLGRVKKVVRMNPDVEMLNNEALQLMAKAAELFIKELSNAA-NQNAALEKRKTVQTKDIDKAIK 99

  Fly    85 KNKNLEFL-------LQIVPQKIRVHQFQEMLRLNRSAGSDDD--DDDDDDDDEEESESESESDE 140
            |.....||       .::.|:|.:|         |.::|.|:.  :::...::|||...|.|.||
 Worm   100 KTWAFAFLEDALDGWPKLEPKKRKV---------NANSGQDETVVEEETIIEEEEEIHVEEEEDE 155

  Fly   141  140
             Worm   156  155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-16NP_001285148.1 CBFD_NFYB_HMF 19..83 CDD:366318 18/62 (29%)
pole-4NP_497087.1 HAP5 <13..>121 CDD:227533 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4125
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.