DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chrac-16 and nfyc-1

DIOPT Version :9

Sequence 1:NP_001285148.1 Gene:Chrac-16 / 32166 FlyBaseID:FBgn0043001 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_493645.1 Gene:nfyc-1 / 173385 WormBaseID:WBGene00017742 Length:232 Species:Caenorhabditis elegans


Alignment Length:84 Identity:21/84 - (25%)
Similarity:40/84 - (47%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LPLSRVRTIMKSSMDTG--LITNEVLFLMTKCTELFVRHLA--GAAYTEEFGQRPGEALKYEHLS 80
            :|::||:.||:...|..  :|.::....|.:..|.|:..:.  |..|..|..:|   .|:...::
 Worm   110 VPMARVKKIMRIDDDVRNFMIASDAPIFMAQAAEFFIEEMTAMGWQYVSEARRR---ILQKADIA 171

  Fly    81 QVVNKNKNLEFLLQIVPQK 99
            ..|.|:...:||:..:|.|
 Worm   172 SAVQKSDQFDFLIDFLPPK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chrac-16NP_001285148.1 CBFD_NFYB_HMF 19..83 CDD:366318 15/66 (23%)
nfyc-1NP_493645.1 HAP5 65..>206 CDD:227533 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.