DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment regucalcin and yellow-e3

DIOPT Version :9

Sequence 1:NP_727588.2 Gene:regucalcin / 32165 FlyBaseID:FBgn0030362 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650288.1 Gene:yellow-e3 / 41651 FlyBaseID:FBgn0038150 Length:409 Species:Drosophila melanogaster


Alignment Length:210 Identity:45/210 - (21%)
Similarity:68/210 - (32%) Gaps:67/210 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 DGVSPSAKVVRTLFEVQPLMEKNRLNDAKVDPRGRFFGGTMRYIGDE-------FEFRHGELYRW 159
            |...||..:...|  |..|.|:...|        |..|| ..||.|.       |:...|..:|.
  Fly   160 DSYIPSVSIFTAL--VVDLAERGTPN--------RCVGG-RAYIADAWGYGLIVFDSLTGRSWRI 213

  Fly   160 EAG----------GQVSVIKGDVGI-SNGLAWDEKAKKFYYIDTTDYEVKSYDYDFETGVASNPK 213
            |..          |:.|  ....|| :..|:..|...:|.|..|    :.|:: :....::....
  Fly   214 EHESMKPSPLLRLGRSS--NSQAGIFTVSLSPSEVEDRFLYFHT----LNSFN-EMRVPLSLINN 271

  Fly   214 VIFNLRKNSPKD--HLLP------DGLTIDTEGNLYVA-----------------TFNGATIYKV 253
            ..|....|:.:|  |.|.      :...:|..||||.:                 |.:...:...
  Fly   272 ETFWKSANASRDSFHSLGTRGIQCESEVMDQSGNLYCSLISLGALVKWEESVSNYTADDLRVVAY 336

  Fly   254 NPNTGKILLEIKFPT 268
            ||:      :|||.|
  Fly   337 NPH------KIKFVT 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
regucalcinNP_727588.2 SGL 31..290 CDD:285626 45/210 (21%)
NHL <229..302 CDD:302697 12/63 (19%)
NHL repeat 229..259 CDD:271320 8/52 (15%)
yellow-e3NP_650288.1 MRJP 110..397 CDD:281074 45/210 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.