DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment regucalcin and yellow-f

DIOPT Version :9

Sequence 1:NP_727588.2 Gene:regucalcin / 32165 FlyBaseID:FBgn0030362 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster


Alignment Length:285 Identity:59/285 - (20%)
Similarity:93/285 - (32%) Gaps:106/285 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GLGEGPH--WDVARQSLYYVDLEAGSLL-RYDYAQNKVYKTKIEGETLAGFVLPVEGRPQEFAVG 91
            |:.|.|:  ..:...|::.:||....|| |::..|:.|   :| |..||...:.|..|....|..
  Fly   159 GMLEFPNNRQQIRHPSIWVIDLANDRLLKRFEIPQSIV---EI-GRGLASITIDVGARRCNDAYA 219

  Fly    92 -----CGRRVVIVN------WDGVSPSAKVVRTLFEVQPLMEKNRLNDAKVDPRGRFFGGTMRYI 145
                 ..||:.:.:      |       ....:.|...||  .:.||                 |
  Fly   220 YIPDLVNRRLHVYHLRSDRIW-------SFEHSFFNFDPL--SDNLN-----------------I 258

  Fly   146 GDEFEFRHGELYRWEAGGQVSVIKGDVG----------------------ISN-------GLAWD 181
            |       |:.:||:.|    :....:|                      :||       ..|..
  Fly   259 G-------GQTFRWDDG----IFSATLGSYKPDGSRDVFFHPMASTNEFVVSNRVLQQEFNAARS 312

  Fly   182 EKAKKFYYIDTTDYEVKS--YDYDFETGV---------------ASNPKVIFN---LRKNSPKDH 226
            :....|:.:.|.....:|  :.||..|||               .|.|....|   :..|| .:.
  Fly   313 DHGDDFHLLGTRGPSTQSTMHKYDPRTGVIFFAEVQKSGVGCWKTSKPFSTENHGSVYSNS-SEM 376

  Fly   227 LLPDGLTIDTEGNLYVATFNGATIY 251
            :.|..||||.||.::|.: |...|:
  Fly   377 IYPSDLTIDEEGYIWVMS-NSMPIF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
regucalcinNP_727588.2 SGL 31..290 CDD:285626 58/284 (20%)
NHL <229..302 CDD:302697 10/23 (43%)
NHL repeat 229..259 CDD:271320 10/23 (43%)
yellow-fNP_524335.1 MRJP 140..428 CDD:281074 59/285 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.