powered by:
Protein Alignment regucalcin and yellow-g2
DIOPT Version :9
Sequence 1: | NP_727588.2 |
Gene: | regucalcin / 32165 |
FlyBaseID: | FBgn0030362 |
Length: | 319 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_647710.1 |
Gene: | yellow-g2 / 38295 |
FlyBaseID: | FBgn0035328 |
Length: | 382 |
Species: | Drosophila melanogaster |
Alignment Length: | 59 |
Identity: | 15/59 - (25%) |
Similarity: | 26/59 - (44%) |
Gaps: | 8/59 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 172 VGISNGLAWDEKAKKFYYIDTTDYEVKSYDYDFETGVASNPKVIFNLRKNSPKDHLLPD 230
:|..||.| .::.:..|.||..:|.: .|.|.:|.|.::..:......|.:||
Fly 296 IGTDNGSA-------IFFRNEGDAEVYRWDTN-STFVEANFKPVYRSQTCQLVTHAVPD 346
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3386 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.