DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment regucalcin and yellow-g

DIOPT Version :9

Sequence 1:NP_727588.2 Gene:regucalcin / 32165 FlyBaseID:FBgn0030362 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster


Alignment Length:333 Identity:68/333 - (20%)
Similarity:104/333 - (31%) Gaps:109/333 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMLLIPVIAVCLFGLTMS---------------YKVEPLPD-SYAGLGEGPHWDVARQSLYYVDL 49
            ::||:...:|.|.|.:.|               ....||.: ::...|...||........||  
  Fly     6 LLLLVASASVVLAGYSSSTDESTDASNSIGGTKCDKNPLNELTFQLSGSSLHWPCESTKNIYV-- 68

  Fly    50 EAGSLLRYDYAQNKVYKTKIEGETLAGFV-LPVEGRPQEFAVGCGRRVVIVNWDGVSPSAKVVRT 113
            ::|.     |....|..|:.:.:..:.|| ||...:...|.:|             ..:.|....
  Fly    69 QSGR-----YVPRNVIVTRAQLQRDSAFVALPRYKQGVPFTLG-------------KVNLKKGEC 115

  Fly   114 LFEVQP-----LMEKNRLN------DAKVDPRGRFFGGTMRYIGDEFEFRHGELYRWEAGGQVSV 167
            |.::.|     :.|:....      |..||..|..                     |..      
  Fly   116 LTKIAPYPCWAIQEEGNCQALQSVVDIAVDQNGLL---------------------WAL------ 153

  Fly   168 IKGDVGISNGLAWDEK--AKKFYYIDTTDYE-VKSYDY-DFETGVASNPKVIFNLRKNSPKDHLL 228
               ||||.|.|....:  :.|...|:|.::: |||.|. |..|..:....::.:..|        
  Fly   154 ---DVGIVNTLEQPIRRCSPKIVAINTANHKVVKSIDLSDLVTSESRLQFIVVDYSK-------- 207

  Fly   229 PDGLTIDTEGNLYVATFNGATIYKVNPNTGKILLEIKFPTKQITSAAFGGPNLDILYVTTAAKFD 293
                  |.:..:|||. .||....|...||.....|..|...       .|..|:|||...:|  
  Fly   208 ------DNKPFVYVAD-AGARSILVYDITGNKSYRIVLPKAT-------APTSDVLYVALTSK-- 256

  Fly   294 QPAPAGTT 301
               |.||:
  Fly   257 ---PDGTS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
regucalcinNP_727588.2 SGL 31..290 CDD:285626 56/274 (20%)
NHL <229..302 CDD:302697 20/73 (27%)
NHL repeat 229..259 CDD:271320 8/29 (28%)
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 41/182 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.