DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment regucalcin and yellow-d

DIOPT Version :9

Sequence 1:NP_727588.2 Gene:regucalcin / 32165 FlyBaseID:FBgn0030362 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_523820.2 Gene:yellow-d / 37703 FlyBaseID:FBgn0041712 Length:432 Species:Drosophila melanogaster


Alignment Length:370 Identity:72/370 - (19%)
Similarity:116/370 - (31%) Gaps:138/370 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MLLIPV-IAVCLFGLTMSYKVEPLPDSYAGLG-EGPHWDVARQSL-YYVDLEAGSLLRYDYAQNK 63
            |:::|: |.:..|.||       |..|| |:| .||......::| .:..||.|    :..||::
  Fly     1 MVMMPLRILLIAFSLT-------LAQSY-GVGVNGPRPVRTVETLTQWGQLEFG----FPTAQDR 53

  Fly    64 VYKTKIEGETLAGFVLPVEG-----RPQEFAVG-------------------------------- 91
                  |....||.::|..|     :||..|.|                                
  Fly    54 ------ENAQAAGNLVPENGTPIDVQPQYMANGQIRLFTTIPRFVTGIPYTLATVSATQGRNGPL 112

  Fly    92 ----------------CGR-----RVVIVN----W---DGVSPSA-----KVVRTLFEVQPLMEK 123
                            |.|     ||.|..    |   .||..:.     ::::.......|:.:
  Fly   113 LQPYPNYSWHNANGEDCDRITSAFRVAITECNQMWVIDSGVIGTTQLCPPQLLQFALATDRLLHR 177

  Fly   124 NRL-NDAKVDPRGRFF----------------GGTMRYIGDE-----FEFRHGELYRWEAGGQVS 166
            .|. ||..: |.|..|                ..||.|:.|.     ..:.|.....|.|..:..
  Fly   178 FRFPNDTYI-PSGSLFITPNVLVQDPPPRGTCSRTMIYVADVSYHGLVVYDHQAQTSWRAENRFM 241

  Fly   167 VIKGDVG----------ISNGL-AWDEKAKKFYY---IDTTDYEVKSYDYDFETGVASNPKVI-- 215
            ....|.|          :.:|: |.:...:..|:   ...::|.|.....:.:...|:.|:.:  
  Fly   242 YPDPDYGKHTIAGESFYLMDGMFALNNDKRNLYFHPLASASEYSVPLSALNRQQNWANGPEALPE 306

  Fly   216 -FNL--RKNSPKDHLLPDGLTIDTEGNLYVATFNGATIYKVNPNT 257
             |.|  |:.|.     .....||...|:|..|||...::..|.|:
  Fly   307 EFRLLGRRRSE-----CAASAIDGRNNVYCVTFNPVKLFVWNVNS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
regucalcinNP_727588.2 SGL 31..290 CDD:285626 62/340 (18%)
NHL <229..302 CDD:302697 9/29 (31%)
NHL repeat 229..259 CDD:271320 9/29 (31%)
yellow-dNP_523820.2 MRJP 133..413 CDD:281074 42/220 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.