DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1492 and Ggt6

DIOPT Version :9

Sequence 1:NP_001303553.1 Gene:CG1492 / 32164 FlyBaseID:FBgn0030361 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001002820.1 Gene:Ggt6 / 408206 RGDID:1303335 Length:498 Species:Rattus norvegicus


Alignment Length:471 Identity:99/471 - (21%)
Similarity:160/471 - (33%) Gaps:149/471 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PDGNAGKKKASRRPPNPEDPLPPSNSPLHR--FSRAAICSDSDVCSQLAKKVLENGGSAVDGALA 89
            |.||.|          |.| ||.|....|.  :..:|:.|.:..||:|.:::|..||:.||..:.
  Rat    84 PKGNLG----------PVD-LPASRHSHHPGVYHHSAVISPAATCSRLGQELLVAGGNVVDAGVG 137

  Fly    90 ALICNGLIGMQSMGIGGGMVMNVYVAKENKSYSILAREMAPLALRADNFSSFRDEQDFKRSGWSI 154
            |.:|..::...:.|:|.......|.:....|.::.|   .|..:.|.                .:
  Rat   138 AALCLAVVHPHATGLGATFWGLFYNSSSGNSTALTA---GPAQILAP----------------GL 183

  Fly   155 AVPAELAGYAVAHQRFGRLKWKDLVLPTLELCRRGYRLYKHQYDALILNQDMIRADSGLRRMFID 219
            .:|..|....:.|..||||.|..|:.....|.::|:     :.||.:.:....:...||..:|..
  Rat   184 GLPTALPALHLLHTHFGRLPWSHLLAKPAMLAQKGF-----EVDAPLASALAAQGTEGLCPLFCH 243

  Fly   220 PDTGRFWPLGHLIRPAAQLCN-------TYDRLANEGPLSFYRGSIADDLLADLKDAGSAITKED 277
            .:.   .|||    ..||:.|       ..:.||:...|.   |:...:||  ::|.|..:... 
  Rat   244 TNG---TPLG----LGAQVTNPNLAAVLLREALASSPDLV---GNALLNLL--VRDLGLELPSV- 295

  Fly   278 LNQAHAKLSSAIVMPLDEYDLHLTPPPGSGHVLGFIMNILKEFRAEFSRAGTMSPRQIHLMVEAM 342
              |....|..|:.:.|.:..|..||.|.:|..|   |.:|:.                       
  Rat   296 --QPKPSLEPALQLLLPQGVLFTTPGPSAGPEL---MGLLES----------------------- 332

  Fly   343 KFGFVKRWQLDESASEELLSNLTSHELAKSVARQINHTHTFNRPEFYGASPGIQIRDEHGTAHTS 407
                                  |.|....|.|...:...|...|    .|..:...|.||:    
  Rat   333 ----------------------TLHSKTPSPASCSSLLQTAETP----VSSALATVDSHGS---- 367

  Fly   408 VLHGNDAVSVTSSINFYFGSGRTGRRTGVIFNNAMSDFSIEQLKNYFDLPFVPGTNGVAPAARPM 472
                  .:.:|||:|..||||.....|||:.:|                        :..::.|.
  Rat   368 ------MLLLTSSLNSSFGSGHLSPSTGVLLSN------------------------LEASSVPS 402

  Fly   473 SSMCPVIVTERATGNV 488
            :..||:|:    .||:
  Rat   403 TWACPLIL----RGNL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1492NP_001303553.1 G_glu_transpept 76..587 CDD:279371 84/420 (20%)
Ggt6NP_001002820.1 G_glu_transpept 123..>394 CDD:302793 77/371 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340051
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.