DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1492 and LOC110439994

DIOPT Version :9

Sequence 1:	NP_001303553.1	Gene:	CG1492 / 32164	FlyBaseID:	FBgn0030361	Length:	592	Species:	Drosophila melanogaster
Sequence 2:	XP_021333878.1	Gene:	LOC110439994 / 110439994	-ID:	-	Length:	131	Species:	Danio rerio

Alignment Length:	132	Identity:	46/132 - (34%)
Similarity:	71/132 - (53%)	Gaps:	27/132 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 SLISVVIVILVAVYIYRYPDGNAGKKKASRRPPNPEDPLPPSNSPLHRFSRAAICSDSDVCSQLA 73
            ||:.:|||||:.|.|..                        ||:   .::.||:.:|:..||::.
Zfish    16 SLVIIVIVILIVVRIVL------------------------SNT---CYNNAAVAADARKCSEIG 53

  Fly    74 KKVLENGGSAVDGALAALICNGLIGMQSMGIGGGMVMNVYVAKENKSYSILAREMAPLALRADNF 138
            :.:|:..|||||.|:|||:|..|:..||||||||:|..:|.|...|..:|.:||.||::...:.|
Zfish    54 RDILQRNGSAVDAAIAALLCVSLVNAQSMGIGGGLVFTIYNASSGKVETINSRETAPMSASENMF 118

  Fly   139 SS 140
            .:
Zfish   119 GT 120

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1492	NP_001303553.1	G_glu_transpept	76..587	CDD:279371	30/65 (46%)
LOC110439994	XP_021333878.1	G_glu_transpept	55..>127	CDD:327525	30/66 (45%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D176986at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010