DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1492 and LOC110439993

DIOPT Version :9

Sequence 1:NP_001303553.1 Gene:CG1492 / 32164 FlyBaseID:FBgn0030361 Length:592 Species:Drosophila melanogaster
Sequence 2:XP_021333876.1 Gene:LOC110439993 / 110439993 -ID:- Length:133 Species:Danio rerio


Alignment Length:80 Identity:36/80 - (45%)
Similarity:53/80 - (66%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RAAICSDSDVCSQLAKKVLENGGSAVDGALAALICNGLIGMQSMGIGGGMVMNVYVAKENKSYSI 123
            :||:.:|:::||::.:.:|...|||||.|:|||:|..:|..||||||||.|..:|.|.......|
Zfish    39 KAAVAADAEICSKIGRDILGRNGSAVDAAIAALLCVSVINPQSMGIGGGSVFTIYNAINGTVEII 103

  Fly   124 LAREMAPLALRADNF 138
            .|||.||::..|:.|
Zfish   104 NARETAPMSATANMF 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1492NP_001303553.1 G_glu_transpept 76..587 CDD:279371 31/63 (49%)
LOC110439993XP_021333876.1 G_glu_transpept 55..>129 CDD:327525 31/64 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D176986at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.