Sequence 1: | NP_001285147.1 | Gene: | CG1806 / 32163 | FlyBaseID: | FBgn0030360 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005077.2 | Gene: | SSPN / 8082 | HGNCID: | 11322 | Length: | 243 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 45/203 - (22%) |
---|---|---|---|
Similarity: | 86/203 - (42%) | Gaps: | 34/203 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 201 LLVMQLAVGLFIVGLAVWILILAPNASILI--NPYLSGLSLLLASIAGLILLRRDHKITEHRPQT 263
Fly 264 NSCYKVLLAESY-VFTGLALIFCCLALVCAAIEFAELISSADGECGPTSSSLLSYHNCTCLAAGE 327
Fly 328 VVANYSSEAPMAFAVGQEEASQNDGCAELRIEWKYLLAFSMALNTL-GIVATFLYITLFICCHRK 391
Fly 392 REHFYTSV 399 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1806 | NP_001285147.1 | None | |||
SSPN | NP_005077.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..43 | ||
CD20 | 64..210 | CDD:367814 | 37/175 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165144346 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR15260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |