DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1806 and SSPN

DIOPT Version :9

Sequence 1:NP_001285147.1 Gene:CG1806 / 32163 FlyBaseID:FBgn0030360 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_005077.2 Gene:SSPN / 8082 HGNCID:11322 Length:243 Species:Homo sapiens


Alignment Length:203 Identity:45/203 - (22%)
Similarity:86/203 - (42%) Gaps:34/203 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LLVMQLAVGLFIVGLAVWILILAPNASILI--NPYLSGLSLLLASIAGLILLRRDHKITEHRPQT 263
            |.::|||:|:.:.  .|..|:.:.::|:|:  .|:.:|:.:.|.:..||.:|...:::.|     
Human    56 LALLQLALGIAVT--VVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDE----- 113

  Fly   264 NSCYKVLLAESY-VFTGLALIFCCLALVCAAIEFAELISSADGECGPTSSSLLSYHNCTCLAAGE 327
            .:|.:..:...| :.:.|.|..|.||:..||..:::|....   |..|..|      |.|     
Human   114 RTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFT---CETTLDS------CQC----- 164

  Fly   328 VVANYSSEAPMAFAVGQEEASQNDGCAELRIEWKYLLAFSMALNTL-GIVATFLYITLFICCHRK 391
               ...|..|::......:.:.   |..:...:|..|...|.||.: |:|.   .:..|:....:
Human   165 ---KLPSSEPLSRTFVYRDVTD---CTSVTGTFKLFLLIQMILNLVCGLVC---LLACFVMWKHR 220

  Fly   392 REHFYTSV 399
            .:.||..|
Human   221 YQVFYVGV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1806NP_001285147.1 None
SSPNNP_005077.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
CD20 64..210 CDD:367814 37/175 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.