DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1806 and sspn

DIOPT Version :9

Sequence 1:NP_001285147.1 Gene:CG1806 / 32163 FlyBaseID:FBgn0030360 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001032669.1 Gene:sspn / 641583 ZFINID:ZDB-GENE-051127-43 Length:168 Species:Danio rerio


Alignment Length:127 Identity:26/127 - (20%)
Similarity:49/127 - (38%) Gaps:34/127 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 ILAPNASILI--NPYLSGLSLLLASIAGLILLRRDHKITEHRPQTNSCYKVLLAESYVF---TGL 280
            :||.::|:|.  .|:.:|:.:.:.|:.|.:|.... ::.:.|.......|:|    |.|   .||
Zfish     1 MLAISSSLLARETPHWAGIIMCVVSLLGFVLFCIT-RVPDERALLQFVIKLL----YFFLCTMGL 60

  Fly   281 ALIFCCLALVC---------AAIEFAE---------------LISSADGECGPTSSSLLSYH 318
            .:....:|..|         :..|..|               .:.||..:|...:|:|..|:
Zfish    61 VMSVVVIAFQCYHYTLTNSFSCREMREDCICTLDPEDPIARMFVFSAVSDCSAITSTLPMYY 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1806NP_001285147.1 None
sspnNP_001032669.1 CD20 5..137 CDD:282023 24/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.