DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1806 and Sspn

DIOPT Version :9

Sequence 1:NP_001285147.1 Gene:CG1806 / 32163 FlyBaseID:FBgn0030360 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_034786.1 Gene:Sspn / 16651 MGIID:1353511 Length:216 Species:Mus musculus


Alignment Length:201 Identity:43/201 - (21%)
Similarity:85/201 - (42%) Gaps:30/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LLVMQLAVGLFIVGLAVWILILAPNASILINPYLSGLSLLLASIAGLILLRRDHKITEHRPQTNS 265
            |.::|||:|:.:..|...:..::|:..:...|:.:|:.:.:.:..||.:|...:::.|     .:
Mouse    29 LALLQLALGIAVTVLGFLMASISPSLLVRDTPFWAGIIVCVVAYLGLFMLCVSYQVDE-----RT 88

  Fly   266 CYKVLLAESY-VFTGLALIFCCLALVCAAIEFAELISSADGECGPTSSSLLSYHNCTCLAAGEVV 329
            |.:..:...| :.:.|.|:.|.||:..||..::.|   |...|.      .|..:|.|       
Mouse    89 CVQFSMKVFYFLLSALGLMVCMLAVAFAAHHYSLL---AQFTCE------TSLDSCQC------- 137

  Fly   330 ANYSSEAPMAFAVGQEEASQNDGCAELRIEWKYLLAFSMALNTL-GIVATFLYITLFICCHRKRE 393
             ...|..|::.|....:.:.   |..:...:|..|...|.||.: |:|.   .:..|:....:.:
Mouse   138 -KLPSSEPLSRAFVYRDVTD---CTSVTGTFKLFLIIQMVLNLVCGLVC---LLACFVMWKHRYQ 195

  Fly   394 HFYTSV 399
            .||..|
Mouse   196 VFYVGV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1806NP_001285147.1 None
SspnNP_034786.1 CD20 37..183 CDD:282023 35/173 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.