DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fw and CFHR1

DIOPT Version :9

Sequence 1:NP_001285146.1 Gene:fw / 32162 FlyBaseID:FBgn0001083 Length:1174 Species:Drosophila melanogaster
Sequence 2:NP_002104.2 Gene:CFHR1 / 3078 HGNCID:4888 Length:330 Species:Homo sapiens


Alignment Length:416 Identity:98/416 - (23%)
Similarity:144/416 - (34%) Gaps:141/416 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 GSSPTCKYVDCGSLPELKFGSIHMSEERTSFGVVAT-----YSCHENY--------TLIGNENRT 507
            |.:..|.:      |::..|.::..|:...|..|.|     |||..|:        |.|     |
Human    18 GEATFCDF------PKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRI-----T 71

  Fly   508 CAMDGWSGKQPECL----VDWCPDPQPIAGGDVRFNDKRAGSTATYVCEPGYVLV-GEAIISCGL 567
            |..:||| ..|:||    ..:..:....:.|.....    |.|...:|..||.|. .|..|||..
Human    72 CTEEGWS-PTPKCLRLCFFPFVENGHSESSGQTHLE----GDTVQIICNTGYRLQNNENNISCVE 131

  Fly   568 GGEWSSKTPSCRFVDCGAPARPNRGIAILLNGTTTVNSVVKYECDEDHWLDGQSELYCTREGKWS 632
            .| ||: .|.||..|...           :|..|..|:         |.|..|...|        
Human   132 RG-WST-PPKCRSTDTSC-----------VNPPTVQNA---------HILSRQMSKY-------- 166

  Fly   633 GEAPVCELVTCETPSVPSGSFVIGYDYNVHSKIQYNCDPGHIMHGTPVLECLDSGEWSADAPYCE 697
                            |||           .:::|.|...:.|.|...:.|| :|.|: :.|.|:
Human   167 ----------------PSG-----------ERVRYECRSPYEMFGDEEVMCL-NGNWT-EPPQCK 202

  Fly   698 YID----CGTILPIPYGSHKYVTNTTYV-GSEVVFSCSQSHKLSGVLKRTCLESAVWSDASPKCE 757
              |    ||...||..|.......:.|. .|.|.:.|...::|.|..:.|| .:..||: .||  
Human   203 --DSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITC-RNGQWSE-PPK-- 261

  Fly   758 EIRCPEPKLAAHSL-------LSVTGNDRMYGRTLIRTSESSQNTAQTYKIGALAKYRCERGYKM 815
               |..|.:.:..:       |..|...::|    :||.||             |::.|:|||::
Human   262 ---CLHPCVISREIMENYNIALRWTAKQKLY----LRTGES-------------AEFVCKRGYRL 306

  Fly   816 VGEA---LATCTDSGQWSGTI--PEC 836
            ...:   ..||     |.|.:  |.|
Human   307 SSRSHTLRTTC-----WDGKLEYPTC 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fwNP_001285146.1 CCP 58..112 CDD:153056
FTP 113..261 CDD:128870
CLECT 281..403 CDD:153057
CCP 408..462 CDD:153056 1/5 (20%)
CCP 466..520 CDD:153056 18/66 (27%)
CCP 525..579 CDD:153056 15/54 (28%)
CCP 583..639 CDD:153056 7/55 (13%)
PHA02927 637..897 CDD:222943 51/217 (24%)
CCP 643..697 CDD:153056 12/53 (23%)
CCP 701..757 CDD:153056 17/56 (30%)
Sushi <799..836 CDD:278512 10/41 (24%)
Sushi 841..896 CDD:278512
CCP 901..955 CDD:153056
CCP 959..1015 CDD:153056
CFHR1NP_002104.2 CCP 90..141 CDD:153056 15/56 (27%)
CCP 147..202 CDD:153056 19/111 (17%)
CCP 208..262 CDD:153056 17/60 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.