DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fw and Cfhr1

DIOPT Version :9

Sequence 1:NP_001285146.1 Gene:fw / 32162 FlyBaseID:FBgn0001083 Length:1174 Species:Drosophila melanogaster
Sequence 2:NP_001037692.1 Gene:Cfhr1 / 289057 RGDID:1310510 Length:274 Species:Rattus norvegicus


Alignment Length:264 Identity:69/264 - (26%)
Similarity:110/264 - (41%) Gaps:52/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 SSPTCKYVDCGSLPELKFGSIHMSEERTSF-----GVVATYSCHENYT---------LIGNENRT 507
            ||...:.:.| ..|:::.|.::..::...|     |.:..|||..|:.         :|      
  Rat    19 SSAKGEGIHC-DFPKIRHGIVYDEKKYEPFSPVPGGKILYYSCEYNFASPSSSFWNPII------ 76

  Fly   508 CAMDGWSGKQPECL-VDWCPDPQ---PIAGGDVRFNDKRAGSTATYVCEPGYVLV-GEAIISCGL 567
            |...||| ..|:|| :.:.|..:   ..:.|...    :.|.....||..||.|. .::.|:||.
  Rat    77 CTEAGWS-PVPKCLRICFFPSVENGHSTSSGQTH----KEGDIVQIVCNQGYSLQNNQSTITCGE 136

  Fly   568 GGEWSSKTPSCRFVD----CGAPARPNRG-IAILLNGTTTVNSVVKYECDEDHWLDGQSELYCTR 627
            .| ||. .|.|...:    ||.|...:.| |..|........|.|:|:|.....|.|...:.| |
  Rat   137 EG-WSI-PPKCISPNSAGKCGPPPSIDNGDITSLSLPEYAPLSSVEYQCQNYFLLKGNKIITC-R 198

  Fly   628 EGKWSGEAPVCELVTCETPS--VPSGSFVIGYDYN--VHSK----IQYNCDPGH-IMHGTPVL-- 681
            .|||| :.|.| |..|..|.  :...:.|:.:..|  ::|:    |::.|.||: .:.|:|..  
  Rat   199 NGKWS-DPPTC-LHACVIPEDILEKHNIVLRWRENGRIYSQSGENIEFMCKPGYRKLRGSPPFRS 261

  Fly   682 ECLD 685
            :|:|
  Rat   262 KCID 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fwNP_001285146.1 CCP 58..112 CDD:153056
FTP 113..261 CDD:128870
CLECT 281..403 CDD:153057
CCP 408..462 CDD:153056 2/4 (50%)
CCP 466..520 CDD:153056 15/67 (22%)
CCP 525..579 CDD:153056 15/57 (26%)
CCP 583..639 CDD:153056 19/56 (34%)
PHA02927 637..897 CDD:222943 15/60 (25%)
CCP 643..697 CDD:153056 13/54 (24%)
CCP 701..757 CDD:153056
Sushi <799..836 CDD:278512
Sushi 841..896 CDD:278512
CCP 901..955 CDD:153056
CCP 959..1015 CDD:153056
Cfhr1NP_001037692.1 CCP 95..146 CDD:153056 15/56 (27%)
CCP 154..208 CDD:153056 19/55 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.