DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fw and clec4m

DIOPT Version :10

Sequence 1:NP_511136.2 Gene:fw / 32162 FlyBaseID:FBgn0001083 Length:1174 Species:Drosophila melanogaster
Sequence 2:XP_017948020.2 Gene:clec4m / 100497637 XenbaseID:XB-GENE-6043650 Length:225 Species:Xenopus tropicalis


Alignment Length:148 Identity:38/148 - (25%)
Similarity:63/148 - (42%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 SPKIGVDTVVTTFSKTCYDFHITKG-ESFDKAQAICKQTGGDLVHDFRGATSSYILSELER--RK 326
            |.:...|:....|:.:||.|  :|. ..::||:|:|.:...||         :.|.||.|:  ..
 Frog    91 SQRSNCDSGWKEFNGSCYYF--SKSIMGWNKARALCLKKESDL---------AVITSENEQDFLY 144

  Fly   327 SELKPQLVWIGAQ--KEPGITSRTWKWVNGD--VVQKPTWGKDQPNNYNGEQNCVVLDGGRNWL- 386
            ...:....|||..  .:.|    .|.||:|.  ......|.:.:||::...::|..:     |. 
 Frog   145 ETTQDDRYWIGLSDTDQEG----AWVWVDGTDYSTSYKFWKEGEPNDHLNNEDCAHM-----WTH 200

  Fly   387 --WNDVGCNLDYLHFICQ 402
              ||||.|:..|.:.||:
 Frog   201 GEWNDVPCSYSYCYAICE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fwNP_511136.2 CCP 58..112 CDD:153056
FTP 113..261 CDD:128870
CLECT 281..403 CDD:153057 35/132 (27%)
PHA02927 <408..578 CDD:222943
PHA02927 <508..696 CDD:222943
PHA02639 643..>837 CDD:165022
PHA02927 798..1014 CDD:222943
clec4mXP_017948020.2 CLECT_DC-SIGN_like 96..219 CDD:153060 37/143 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.