DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fw and arc3

DIOPT Version :10

Sequence 1:NP_511136.2 Gene:fw / 32162 FlyBaseID:FBgn0001083 Length:1174 Species:Drosophila melanogaster
Sequence 2:NP_001120599.1 Gene:arc3 / 100145756 XenbaseID:XB-GENE-6454074 Length:562 Species:Xenopus tropicalis


Alignment Length:58 Identity:12/58 - (20%)
Similarity:26/58 - (44%) Gaps:3/58 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 GDIDMAELEDETLNEDVTDNGISGLDTSEFTGVAALSAIADLQQQMDELKNTMRDAIA 179
            |:::....|.|.|.:.:.|...:..|.:....|:.|..:..:|.:   .:.|:|..:|
 Frog     2 GEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMR---TRRTLRGHLA 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fwNP_511136.2 CCP 58..112 CDD:153056
FTP 113..261 CDD:128870 12/58 (21%)
CLECT 281..403 CDD:153057
PHA02927 <408..578 CDD:222943
PHA02927 <508..696 CDD:222943
PHA02639 643..>837 CDD:165022
PHA02927 798..1014 CDD:222943
arc3NP_001120599.1 CCP 28..87 CDD:153056 6/32 (19%)
PHA02927 86..332 CDD:222943
PHA02927 331..>510 CDD:222943
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.