DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18130 and TRX1

DIOPT Version :10

Sequence 1:NP_572772.1 Gene:CG18130 / 32161 FlyBaseID:FBgn0030359 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_190672.1 Gene:TRX1 / 824267 AraportID:AT3G51030 Length:114 Species:Arabidopsis thaliana


Alignment Length:122 Identity:32/122 - (26%)
Similarity:58/122 - (47%) Gaps:18/122 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKKGGQQQLQADIQT-DEELERFMERPGLLVLDVYSEWCGPCQGMV---GSLRK-----IKLDV 56
            ||.:.||......::| :|:|::..|...|:|:|..:.|||||:.:.   ..|.|     :.|.|
plant     1 MASEEGQVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKV 65

  Fly    57 GGDNLHLAICKSDTITALKRFNKRSEPIWLFVTGGRAVNLLFGSDVPKLVSLLVKEL 113
            ..|.|. ::.....|.|:        |.::|:..|:.::.:.|:...:|.|.:.|.|
plant    66 DTDELK-SVASDWAIQAM--------PTFMFLKEGKILDKVVGAKKDELQSTIAKHL 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18130NP_572772.1 TRX_NDPK 11..112 CDD:239246 26/109 (24%)
DUF4746 234..554 CDD:435025
TRX1NP_190672.1 TRX_family 19..110 CDD:239245 25/99 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.